Use Able AI chat for product recommendations

Titin Polyclonal antibody

Titin Polyclonal Antibody for IHC, IF/ICC, IF-P, ELISA

Cat No. 27867-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

IHC, IF/ICC, IF-P, ELISA

TTN

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inmouse heart tissue, mouse skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse skeletal muscle tissue, mouse heart tissue
Positive IF/ICC detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27867-1-AP targets Titin in IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27496

Product name: Recombinant human TTN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 33738-33969 aa of NM_001256850

Sequence: MFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIK

Predict reactive species
Full Name titin
Calculated Molecular Weight 3816 kDa
GenBank Accession NumberNM_001256850
Gene Symbol Titin
Gene ID (NCBI) 7273
RRIDAB_2880998
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8WZ42
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Titin, or connectin, is a giant muscle protein expressed in the cardiac and skeletal muscles that spans half of the sarcomere from Z line to M line. It plays a key role in muscle contraction and relaxation, maintaining the structural integrity of the myotome(PMID: 11846417). Mutations in Titin are associated with familial hypertrophic cardiomyopathy 9, and autoantibodies to titin are produced in patients with the autoimmune disease scleroderma(PMID: 15802564).

Protocols

Product Specific Protocols
IF protocol for Titin antibody 27867-1-APDownload protocol
IHC protocol for Titin antibody 27867-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseIF

Elife

A transcriptome atlas of the mouse iris at single-cell resolution defines cell types and the genomic response to pupil dilation.

Authors - Jie Wang
mouseIF

Dev Biol

Aberrant differentiation of second heart field mesoderm prefigures cellular defects in the outflow tract in response to loss of FGF8

Authors - Sophie Astrof
ratIF

Sci Rep

Phase-targeting rapid cryofixation of the beating heart and histological analysis unveil contractile state-dependent sarcomere dynamics.

Authors - Shoko Tamura
humanIF

Int J Cardiol

Identification of the non-canonical splice-disrupting variants of TTN in dilated cardiomyopathy.

Authors - Linlin Wang
humanIF

Stem Cell Res

Generation of a human induced pluripotent stem cell line YCMi004-A from a patient with dilated cardiomyopathy carrying a protein-truncating mutation of the Titin gene and its differentiation towards cardiomyocytes

Authors - Sun-Ho Lee
mouseIF

Physiol Rep

Germline deletion of Rgs2 and/or Rgs5 in male mice does not exacerbate left ventricular remodeling induced by subchronic isoproterenol infusion

Authors - Shelby Dahlen

Reviews

    4.5 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Víctor (Verified Customer) (01-26-2023)

The antibody is a bit dirty but specific for muscle cells. I'm trying to evaluate specific sarcomeric structures with higher magnifications, and they seem to be marked. So the antibody is OK.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:400
  • Cell Tissue Type: Skeletal muscle cells obtained by direct cell reprogramming approaches
Titin Antibody Immunofluorescence validation (1:400 dilution) in Skeletal muscle cells obtained by direct cell reprogramming approaches (Cat no:27867-1-AP)

Joseph (Verified Customer) (01-14-2020)

I tested the Titin antibody using IHC on 16uM mouse skeletal muscle sections (Tibialis anterior and Soleus) using 1:100 and 1:300 dilutions. Both dilutions worked very well.

  • Applications: Immunohistochemistry,
  • Primary Antibody Dilution: 1:300
  • Cell Tissue Type: Mouse Skeletal Muscle - Soleus, tibialis anterior
Loading...
||
New chat

Able™

正在加载,请稍候...