Tested Applications
| Positive WB detected in | mouse skeletal muscle tissue, rat skeletal muscle tissue |
| Positive IHC detected in | rat brain tissue, mouse brain tissue, mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28270-1-AP targets Calmodulin 1/2/3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28000 Product name: Recombinant human CALM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 72-149 aa of BC006464 Sequence: MMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK Predict reactive species |
| Full Name | calmodulin 2 (phosphorylase kinase, delta) |
| Calculated Molecular Weight | 17 kDa |
| Observed Molecular Weight | 17-22 kDa |
| GenBank Accession Number | BC006464 |
| Gene Symbol | Calmodulin 1 |
| Gene ID (NCBI) | 805 |
| RRID | AB_3669650 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62158 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Calmodulin is the most widely distributed and most versatile member of a family of calcium-binding proteins which probably serve as receptors for the Ca2+ signal. Through the regulation of a wide variety of intracellular enzymes, calmodulin plays a key role in many physiological processes (PMID: 6313166).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Calmodulin 1/2/3 antibody 28270-1-AP | Download protocol |
| IHC protocol for Calmodulin 1/2/3 antibody 28270-1-AP | Download protocol |
| WB protocol for Calmodulin 1/2/3 antibody 28270-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Calmodulin 1/2/3 Polyclonal antibody (Cat# 28270-1-AP) has 3 citations published in Food Research International, International Journal of Biological Macromolecules, and Molecular Biology and Evolution. The research fields span food science (muscle protein dynamics during cold storage), gastrointestinal pharmacology (autophagy-mediated apoptosis in interstitial cells of Cajal via AKT1 signaling), and evolutionary biology (adaptive evolution of endothelial NOS in cetaceans).
| Species | Application | Title |
|---|---|---|
Food Res Int Actin-myosin complex dissociation initiates programmed cell death during cold storage of grass carp muscle. | ||
Int J Biol Macromol Naringenin from Citrus aurantium L. alleviates loperamide-induced constipation by inhibiting excessive autophagy-mediated apoptosis in interstitial cells of Cajal via the AKT1 signaling pathway. | ||
Mol Biol Evol Adaptive evolution of endothelial nitric oxide synthase (NOS3) may reduce cetacean susceptibility to decompression sickness. |
