Tested Applications
| Positive WB detected in | K-562 cells, NIH/3T3 cells, mouse brain tissue, mouse heart tissue, Sp2/0 cells |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30539-1-AP targets ALAS2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30308 Product name: Recombinant human ALAS2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 502-574 aa of BC030230 Sequence: LLRLAPSPHHSPQMMEDFVEKLLLAWTAVGLPLQDVSVAACNFCRRPVHFELMSEWERSYFGNMGPQYVTTYA Predict reactive species |
| Full Name | aminolevulinate, delta-, synthase 2 |
| Calculated Molecular Weight | 587 aa, 65 kDa |
| Observed Molecular Weight | 65 kDa |
| GenBank Accession Number | BC030230 |
| Gene Symbol | ALAS2 |
| Gene ID (NCBI) | 212 |
| RRID | AB_3086355 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P22557 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The heme biosynthetic pathway begins from delta aminolevulinic acid synthase (ALAS) catalyzing the condensation of glycine and succinyl-CoA to delta aminolevulinic acid (ALA) in the mitochondria. ALAS is coded by two genes: ALAS1 and ALAS2 . ALAS1 is ubiquitously expressed in all cells, and the negative feedback is regulated by the heme pool; however, ALAS2 is specifically expressed only in erythroid cells.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ALAS2 antibody 30539-1-AP | Download protocol |
| WB protocol for ALAS2 antibody 30539-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ALAS2 Polyclonal antibody (Cat# 30539-1-AP) has 1 total citation. It was cited in Nature (2026) in a study titled "An ancient mitochondrial program tunes translation to haem availability," which falls within the research fields of mitochondrial biology, heme biosynthesis, and translational regulation. The antibody was used for Western blot (WB) in human samples.
| Species | Application | Title |
|---|---|---|
