Tested Applications
| Positive WB detected in | A-253 cells, SW 1990 cells, HaCaT cells, HT-1376 cells, Karpas-422 cells, Karpas-299 cells, HuT 78 cells, K-562 cells, TF-1 cells |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | K-562 cells, Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60074-1-Ig targets IFITM1-Specific in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2320 Product name: Recombinant human IFITM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-125 aa of BC000897 Sequence: MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY Predict reactive species |
| Full Name | interferon induced transmembrane protein 1 (9-27) |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 14-17 kDa |
| GenBank Accession Number | BC000897 |
| Gene Symbol | IFITM1 |
| Gene ID (NCBI) | 8519 |
| RRID | AB_2233405 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P13164 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IFITM1(interferon induced transmembrane protein), also named DSPA2a and interferon-induced protein 17 (IFI17), belongs to the CD225 family. It has two transmembrane domain and serves as an IFN-induced antiviral protein that mediates cellular innate immunity to at least three major human pathogens, influenza A H1N1 virus, West Nile virus (WNV), and dengue virus , by inhibiting the early steps of replication. IFITM proteins are recently identified as viral restriction factors that inhibit infection mediated by the influenza A virus (IAV) hemagglutinin (HA) protein. Also they serve as important components of the innate immune system to restrict HIV-1 infection. 60074-1-Ig is a mouse monoclonal antibody which specifically recognizing IFITM1 but not IFITM2 or IFITM3.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IFITM1-Specific antibody 60074-1-Ig | Download protocol |
| IHC protocol for IFITM1-Specific antibody 60074-1-Ig | Download protocol |
| IP protocol for IFITM1-Specific antibody 60074-1-Ig | Download protocol |
| WB protocol for IFITM1-Specific antibody 60074-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The IFITM1 antibody (catalog number 60074-1-Ig) has 92 citations. These appear in high-impact journals including Science, Cell, Cell Host & Microbe, EMBO Journal, Nature Microbiology, Nature Communications, PNAS, Hepatology, Gastroenterology, Journal of Virology, Retrovirology, and Frontiers in Immunology. The research fields span antiviral and innate immunity, interferon signaling, and viral infection (HIV, influenza, SARS-CoV-2, Zika, dengue, hepatitis C), as well as cancer biology, placental development, and gene therapy. Applications are predominantly Western blot, with some IF, IHC, and flow cytometry.
| Species | Application | Title |
|---|---|---|
Science IFITM proteins inhibit placental syncytiotrophoblast formation and promote fetal demise. | ||
Cell The IFITM proteins mediate cellular resistance to influenza A H1N1 virus, West Nile virus, and dengue virus. | ||
Cell Host Microbe Resistance of Transmitted Founder HIV-1 to IFITM-Mediated Restriction.
|
Reviews
What customers say
The antibody performed well for analyzing IFITM1 expression in permanent cell lines. It was used for both Western Blot (1:20,000 dilution) and Immunofluorescence (1:400 dilution), and the reviewer gave it a 5-star rating.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Claudia (Verified Customer) (06-20-2022) | The antibody worked very well for the analysis of IFITM1 expression in permanent cell lines.
|
