CoraLite® Plus 488-conjugated IFITM1-Specific Monoclonal antibody

• 

  IF Staining of K-562 using CL488-60074

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using CoraLite® Plus 488 IFITM1-Specific antibody (CL488-60074, Clone: 5B5E2 ) at dilution of 1:200.

• Featured Product
• KD/KO Validated

IFITM1-Specific Monoclonal Antibody for IF/ICC

Cat No. CL488-60074

Clone No.5B5E2

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

IF/ICC

Synonyms

9 27, CD225, IFI17, IFITM1, IFITM1-Specific, Interferon induced protein 17, Leu 13 antigen, LEU13

---

Tested Applications

• Positive IF/ICC detected in: K-562 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60074 targets IFITM1-Specific in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2320

  Product name: Recombinant human IFITM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-125 aa of BC000897

  Sequence: MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY

• Full Name: interferon induced transmembrane protein 1 (9-27)
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14 kDa, 17 kDa
• GenBank Accession Number: BC000897
• Gene Symbol: IFITM1
• Gene ID (NCBI): 8519
• RRID: AB_2919229
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P13164
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

IFITM1(interferon induced transmembrane protein), also named DSPA2a and interferon-induced protein 17 (IFI17), belongs to the CD225 family. It has two transmembrane domain and serves as an IFN-induced antiviral protein that mediates cellular innate immunity to at least three major human pathogens, influenza A H1N1 virus, West Nile virus (WNV), and dengue virus , by inhibiting the early steps of replication. IFITM proteins are recently identified as viral restriction factors that inhibit infection mediated by the influenza A virus (IAV) hemagglutinin (HA) protein. Also they serve as important components of the innate immune system to restrict HIV-1 infection. 60074-1-Ig is a mouse monoclonal antibody which specifically recognizing IFITM1 but not IFITM2 or IFITM3.