• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated IFITM1-Specific Monoclonal antibody

IFITM1-Specific Monoclonal Antibody for IF/ICC
Cat No. CL488-60074
Clone No.5B5E2

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

IF/ICC

9 27, CD225, IFI17, IFITM1, IFITM1-Specific, Interferon induced protein 17, Leu 13 antigen, LEU13

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inK-562 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60074 targets IFITM1-Specific in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2320

Product name: Recombinant human IFITM1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-125 aa of BC000897

Sequence: MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY

Predict reactive species
Full Name interferon induced transmembrane protein 1 (9-27)
Calculated Molecular Weight 14 kDa
Observed Molecular Weight 14 kDa, 17 kDa
GenBank Accession NumberBC000897
Gene Symbol IFITM1
Gene ID (NCBI) 8519
RRIDAB_2919229
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP13164
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

IFITM1(interferon induced transmembrane protein), also named DSPA2a and interferon-induced protein 17 (IFI17), belongs to the CD225 family. It has two transmembrane domain and serves as an IFN-induced antiviral protein that mediates cellular innate immunity to at least three major human pathogens, influenza A H1N1 virus, West Nile virus (WNV), and dengue virus , by inhibiting the early steps of replication. IFITM proteins are recently identified as viral restriction factors that inhibit infection mediated by the influenza A virus (IAV) hemagglutinin (HA) protein. Also they serve as important components of the innate immune system to restrict HIV-1 infection. 60074-1-Ig is a mouse monoclonal antibody which specifically recognizing IFITM1 but not IFITM2 or IFITM3.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 IFITM1-Specific antibody CL488-60074Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...