Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

PFN2 Monoclonal antibody

PFN2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 60094-2-Ig
Clone No. 2H7C12
Publications (9)
Reviews (2)
Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Prifilin 2, Profilin II, profilin 2, PFL, D3S1319E

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for PFN2 in ?

Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue
Positive IHC detected inhuman lung cancer tissue, human skeletal muscle tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60094-2-Ig targets PFN2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, chicken
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5043

Product name: Recombinant human PFN2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-140 aa of BC018049

Sequence: MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF

Predict reactive species
Full Name profilin 2
Calculated Molecular Weight 140 aa, 15 kDa
Observed Molecular Weight 15 kDa
GenBank Accession NumberBC018049
Gene Symbol PFN2
Gene ID (NCBI) 5217
RRIDAB_2163215
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP35080
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PFN2 (profilin 2) is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. The MW of this protein is 15 kDa, and this antibody specially recognises the 15 kDa protein.

Protocols

Product Specific Protocols
IF protocol for PFN2 antibody 60094-2-IgDownload protocol
IHC protocol for PFN2 antibody 60094-2-IgDownload protocol
WB protocol for PFN2 antibody 60094-2-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-PFN2 (Profilin 2) antibody, catalog number 60094-2-Ig, has 9 total citations spanning journals including Advanced Science, International Journal of Biological Macromolecules, Molecular Medicine, International Journal of Oncology, Journal of Cell Biology, Frontiers in Molecular Neuroscience, Journal of Mammary Gland Biology and Neoplasia, Biochemical and Biophysical Research Communications, and eLife. Research fields cover ferroptosis in prostate cancer, antiviral mechanisms, diabetic nephropathy, colorectal cancer metastasis, corticogenesis, neuroprotection, breast cancer radiosensitivity, and synaptic pruning.

SpeciesApplicationTitle
humanWB

Adv Sci (Weinh)

ZDHHC2-Dependent Palmitoylation Dictates Ferroptosis and Castration Sensitivity in Prostate Cancer via Controlling ACSL4 Degradation and Lipid Peroxidation

Authors - Shuai Shao
chickenWB

Int J Biol Macromol

Unveiling the host arsenal: Interactome profiling of ALV-J p32 integrase reveals novel antiviral targets.

Authors - Liyi Chen
humanWB,IHC

Mol Med

ets1 associates with KMT5A to participate in high glucose-mediated EndMT via upregulation of PFN2 expression in diabetic nephropathy.

Authors - Lihong Lu
  • KD Validated
humanWB,IHC

Int J Oncol

Loss of profilin 2 contributes to enhanced epithelial-mesenchymal transition and metastasis of colorectal cancer.

Authors - Hui Zhang
mouseWB

J Cell Biol

NCAM regulates temporal specification of neural progenitor cells via profilin2 during corticogenesis.

Authors - Rui Huang
  • KD Validated
mouseWB

Front Mol Neurosci

Integrated proteomics and metabolomics analysis of D-pinitol function during hippocampal damage in streptozocin-induced aging-accelerated mice

Authors - Xiaoxia Li

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

Both reviews are 5-star ratings from Western Blot applications using lot 10056368. One reviewer (Ziwei S.) simply stated it "works as it should be." The other (Miriam L.) tested it on U2OS cells at a 1:1000 dilution and included an image but left no written comment. Overall, customers report reliable performance with no negative feedback.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Ziwei (Verified Customer) (01-04-2026)

works as it should be.

  • Applications: Western Blot

Miriam (Verified Customer) (10-13-2025)

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: U2OS
PFN2 Antibody Western Blot validation (1:1000 dilution) in U2OS (Cat no:60094-2-Ig)
Loading...
||
New chat

Able™

正在加载,请稍候...