Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IHC detected in | human lung cancer tissue, human skeletal muscle tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60094-2-Ig targets PFN2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, chicken |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5043 Product name: Recombinant human PFN2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-140 aa of BC018049 Sequence: MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF Predict reactive species |
| Full Name | profilin 2 |
| Calculated Molecular Weight | 140 aa, 15 kDa |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC018049 |
| Gene Symbol | PFN2 |
| Gene ID (NCBI) | 5217 |
| RRID | AB_2163215 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P35080 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PFN2 (profilin 2) is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. The MW of this protein is 15 kDa, and this antibody specially recognises the 15 kDa protein.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PFN2 antibody 60094-2-Ig | Download protocol |
| IHC protocol for PFN2 antibody 60094-2-Ig | Download protocol |
| WB protocol for PFN2 antibody 60094-2-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-PFN2 (Profilin 2) antibody, catalog number 60094-2-Ig, has 9 total citations spanning journals including Advanced Science, International Journal of Biological Macromolecules, Molecular Medicine, International Journal of Oncology, Journal of Cell Biology, Frontiers in Molecular Neuroscience, Journal of Mammary Gland Biology and Neoplasia, Biochemical and Biophysical Research Communications, and eLife. Research fields cover ferroptosis in prostate cancer, antiviral mechanisms, diabetic nephropathy, colorectal cancer metastasis, corticogenesis, neuroprotection, breast cancer radiosensitivity, and synaptic pruning.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) ZDHHC2-Dependent Palmitoylation Dictates Ferroptosis and Castration Sensitivity in Prostate Cancer via Controlling ACSL4 Degradation and Lipid Peroxidation | ||
Int J Biol Macromol Unveiling the host arsenal: Interactome profiling of ALV-J p32 integrase reveals novel antiviral targets. | ||
Mol Med ets1 associates with KMT5A to participate in high glucose-mediated EndMT via upregulation of PFN2 expression in diabetic nephropathy.
| ||
Int J Oncol Loss of profilin 2 contributes to enhanced epithelial-mesenchymal transition and metastasis of colorectal cancer. | ||
J Cell Biol NCAM regulates temporal specification of neural progenitor cells via profilin2 during corticogenesis.
| ||
Front Mol Neurosci Integrated proteomics and metabolomics analysis of D-pinitol function during hippocampal damage in streptozocin-induced aging-accelerated mice |
Reviews
What customers say
Both reviews are 5-star ratings from Western Blot applications using lot 10056368. One reviewer (Ziwei S.) simply stated it "works as it should be." The other (Miriam L.) tested it on U2OS cells at a 1:1000 dilution and included an image but left no written comment. Overall, customers report reliable performance with no negative feedback.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Ziwei (Verified Customer) (01-04-2026) | works as it should be.
|
Miriam (Verified Customer) (10-13-2025) |
![]() |


















