PFN2 Monoclonal antibody, PBS Only

• 

  WB analysis of mouse brain using 60094-2-Ig (same clone as 60094-2-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 60094-2-Ig (PFN2 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60094-2-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 60094-2-Ig (same clone as 60094-2-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 60094-2-Ig (PFN2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60094-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 60094-2-Ig (same clone as 60094-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 60094-2-Ig (PFN2 Antibody) at dilution of 1:400 (under 40x lens). This data was developed using the same antibody clone with 60094-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 60094-2-Ig (same clone as 60094-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 60094-2-Ig (PFN2 Antibody) at dilution of 1:400 (under 10x lens). This data was developed using the same antibody clone with 60094-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 60094-2-Ig (same clone as 60094-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 60094-2-Ig (PFN2 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60094-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 60094-2-Ig (same clone as 60094-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 60094-2-Ig (PFN2 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60094-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 60094-2-Ig (same clone as 60094-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 60094-2-Ig (PFN2 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 60094-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 60094-2-Ig (same clone as 60094-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 60094-2-Ig (PFN2 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 60094-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 60094-2-Ig (same clone as 60094-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PFN2 antibody (60094-2-Ig, Clone: 2H7C12 ) at dilution of 1:500 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ). This data was developed using the same antibody clone with 60094-2-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PFN2 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 60094-2-PBS

Clone No.2H7C12

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Prifilin 2, Profilin II, profilin 2, PFL, D3S1319E

---

Product Information

60094-2-PBS targets PFN2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5043

  Product name: Recombinant human PFN2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-140 aa of BC018049

  Sequence: MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF

• Full Name: profilin 2
• Calculated Molecular Weight: 140 aa, 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC018049
• Gene Symbol: PFN2
• Gene ID (NCBI): 5217
• RRID: AB_2163215
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35080
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PFN2 (profilin 2) is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. The MW of this protein is 15 kDa, and this antibody specially recognises the 15 kDa protein.