CD34 Monoclonal antibody

CD34 Monoclonal Antibody for WB, IHC, ELISA
Cat No. 60180-2-Ig
Clone No.4F11H3

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF, ELISA

CD34 molecule, 4F11H3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman placenta tissue, human ovary cancer cells, human uterus tissue, human testis tissue
Positive IHC detected inhuman tonsillitis tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:5000-1:20000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60180-2-Ig targets CD34 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5996

Product name: Recombinant human CD34 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 34-287 aa of BC039146

Sequence: DNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYS

Predict reactive species
Full Name CD34 molecule
Calculated Molecular Weight 41 kDa
Observed Molecular Weight105 kDa
GenBank Accession NumberBC039146
Gene Symbol CD34
Gene ID (NCBI) 947
RRIDAB_2881354
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP28906
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD34 is a 105- to 120-kDa glycophosphoprotein expressed on the majority of hematopoietic stem/progenitor cells, bone marrow stromal cells, capillary endothelial cells, embryonic fibroblasts, and some nerve tissue. CD34 is a commonly used marker for identifying human hematopoietic stem/progenitor cells and mediates cell adhesion and lymphocyte homing by binding L-selectin and E-selectin ligands. CD34 is also one of the best negative selection markers for characterizing and/or isolating human MSCs from bone marrow and other sources. Along with other positive selection markers (such as CD29, CD44, CD90, CD105 and CD166), negative selection markers (such as CD34 and CD45) are used for MSC identification. The calculated molecular mass of human CD34 is 41 kDa, various forms with different molecular weights may be produced due to different glycosylation patterns and alternative splicing (PMID: 24375067; 15750786).

Protocols

Product Specific Protocols
IHC protocol for CD34 antibody 60180-2-IgDownload protocol
WB protocol for CD34 antibody 60180-2-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Front Oncol

Prognostic Impact of the Angiogenic Gene POSTN and Its Related Genes on Lung Adenocarcinoma.

Authors - Dongfeng Sun

BMC Cancer

Novel fusion protein PK5-RL-Gal-3C inhibits hepatocellular carcinoma via anti-angiogenesis and cytotoxicity

Authors - Xiaoge Gao
humanIF

STAR Protoc

Skin-iDISCO+: An optimized tissue-clearing and labeling protocol for morphometric analysis of human cutaneous vasculature

Authors - Léa Pechtimaldjian
Loading...
||
New chat Able
正在加载,请稍候...