Tested Applications
| Positive WB detected in | MOLT-4 cells, Jurkat cells, human PBMCs |
| Positive IHC detected in | human tonsillitis tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
| Positive IF/ICC detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:3200-1:12800 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 20 publications below |
| IF | See 24 publications below |
| FC | See 1 publications below |
Product Information
60181-1-Ig targets CD3 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11797 Product name: Recombinant human CD3E protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-207 aa of BC049847 Sequence: MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI Predict reactive species |
| Full Name | CD3e molecule, epsilon (CD3-TCR complex) |
| Calculated Molecular Weight | 207 aa, 23 kDa |
| Observed Molecular Weight | 23 kDa |
| GenBank Accession Number | BC049847 |
| Gene Symbol | CD3 |
| Gene ID (NCBI) | 916 |
| ENSEMBL Gene ID | ENSG00000198851 |
| RRID | AB_10859262 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P07766 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells. This anti-CD3 is a monoclonal antibody directed against the epsilon chain of human CD3 molecule.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD3 antibody 60181-1-Ig | Download protocol |
| IHC protocol for CD3 antibody 60181-1-Ig | Download protocol |
| WB protocol for CD3 antibody 60181-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Commun (Lond) Targeting autophagy overcomes cancer-intrinsic resistance to CAR-T immunotherapy in B-cell malignancies | ||
J Med Virol Combination of novel oncolytic herpesvirus with paclitaxel as an efficient strategy for breast cancer therapy | ||
EBioMedicine Patient-derived melanoma organoid models facilitate the assessment of immunotherapies | ||
Autophagy Autophagy loss impedes cancer-associated fibroblast activation via downregulating proline biosynthesis. | ||
Pharmacol Res Mesothelin CAR-T cells expressing tumor-targeted immunocytokine IL-12 yield durable efficacy and fewer side effects | ||
Sci Signal ALOX5 drives the pyroptosis of CD4+ T cells and tissue inflammation in rheumatoid arthritis |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Maelle (Verified Customer) (01-03-2025) | Very low signal
|

























