Featured Product
KD/KO Validated

TMEM70 Monoclonal antibody

TMEM70 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 60195-1-Ig

Clone No. 2C11C3

Publications (1)

Review Product

Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

2C11C3, transmembrane protein 70

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF-P

WB analysis of A2780 using 60195-1-Ig
A2780 cells were subjected to SDS PAGE followed by western blot with 60195-1-Ig (TMEM70 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 60195-1-Ig
WB result of TMEM70 antibody (60195-1-Ig; 1:1500; incubated at room temperature for 1.5 hours) with sh-Control and sh-TMEM70 transfected HeLa cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 60195-1-Ig
Immunohistochemical analysis of paraffin-embedded human liver using 60195-1-Ig(TMEM70 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 60195-1-Ig
Immunohistochemical analysis of paraffin-embedded human liver using 60195-1-Ig(TMEM70 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas using 60195-1-Ig
Immunohistochemical analysis of paraffin-embedded human pancreas using 60195-1-Ig(TMEM70 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas using 60195-1-Ig
Immunohistochemical analysis of paraffin-embedded human pancreas using 60195-1-Ig(TMEM70 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse brain using 60195-1-Ig
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using TMEM70 antibody (60195-1-Ig, Clone: 2C11C3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TMEM70 in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	A2780 cells, HeLa cells
Positive IHC detected in	human liver tissue, human pancreas tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	mouse brain tissue

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunohistochemistry (IHC)	IHC : 1:20-1:200
Immunofluorescence (IF)-P	IF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60195-1-Ig targets TMEM70 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	human
Host / Isotype	Mouse / IgG2b
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag16947 Product name: Recombinant human TMEM70 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 148-260 aa of BC002748 Sequence: MGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDK Predict reactive species
Full Name	transmembrane protein 70
Calculated Molecular Weight	260 aa, 29 kDa
Observed Molecular Weight	18 kDa
GenBank Accession Number	BC002748
Gene Symbol	TMEM70
Gene ID (NCBI)	54968
RRID	AB_10896316
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q9BUB7
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMEM70 belongs to the TMEM70 family. It is involved in biogenesis of mitochondrial ATP synthase. Defects in TMEM70 are a cause of mitochondrial encephalocardiomyopathy neonatal due to ATP synthase deficiency (MT-ATPSD). A publication (PMID:21147908) identified TMEM70 gene defect as a pan-ethnic disorder and further redefined it as the most common cause of nuclear-origin ATP synthase deficiency.

Protocols

Product Specific Protocols
IF protocol for TMEM70 antibody 60195-1-Ig	Download protocol
IHC protocol for TMEM70 antibody 60195-1-Ig	Download protocol
WB protocol for TMEM70 antibody 60195-1-Ig	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The TMEM70 Monoclonal antibody (2C11C3), catalog number 60195-1-Ig, has a total of 1 citation. This citation appears in the journal Mitochondrion (2014, Impact Factor 5.7). The cited study investigated mitochondrial membrane assembly of the TMEM70 protein in human samples using Western blot. The associated research field is mitochondrial biology, specifically related to biogenesis of mitochondrial ATP synthase.