Tested Applications
| Positive WB detected in | LNCaP cells, rat kidney tissue, HeLa cells, HepG2 cells, Jurkat cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, 4T1 cells |
| Positive IHC detected in | human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60201-1-Ig targets UBC9 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, monkey |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7885 Product name: Recombinant human UBC9 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-184 aa of BC004437 Sequence: VPGTLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYWLVAALAPLVAAPPRPSQGRLAGREWSTQAHPRDSQGPRLC Predict reactive species |
| Full Name | ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast) |
| Calculated Molecular Weight | 18 kDa |
| Observed Molecular Weight | 18 kDa |
| GenBank Accession Number | BC004437 |
| Gene Symbol | UBC9 |
| Gene ID (NCBI) | 7329 |
| RRID | AB_10918977 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P63279 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
UBC9 is also named as UBE2I, UBCE9 and belongs to the ubiquitin-conjugating enzyme family. It is a homologue of the E2 ubiquitin conjugating enzyme and participates in the covalent linking of SUMO-1 molecule to the target protein. This protein is present at a high level in spleen and lung. Moderate level of UBC9 is detected in kidney and liver. Low amount of UBC9 is observed in brain, whereas the 18 kDa band of UBC9 is barely visible or absent in heart and skeletal muscle. In heart and muscle extracts the UBC9 antibodies recognizes a 38 kDa protein band,but this band is not visible in extracts of other rat tissues(PMID:14739995).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for UBC9 antibody 60201-1-Ig | Download protocol |
| WB protocol for UBC9 antibody 60201-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The UBC9 Monoclonal antibody (4A10B11), catalog number 60201-1-Ig, has 1 citation. It was used in a study published in Viruses (2023) investigating how the SARS-CoV-2 Nucleocapsid protein interacts with UBC9 to inhibit MAVS ubiquitination via enhanced SUMOylation. The research falls within virology and innate immune signaling, with applications in Western blot and immunofluorescence across human and monkey samples.
| Species | Application | Title |
|---|---|---|
Viruses The Interaction between SARS-CoV-2 Nucleocapsid Protein and UBC9 Inhibits MAVS Ubiquitination by Enhancing Its SUMOylation |
Reviews
What customers say
The single review for this UBC9 mouse monoclonal antibody rates it 5 stars for Western Blot. The user tested it on hTERT-RPE1 and U-2 OS cells at a 1:1000 dilution, using 5% skim milk in TBS-T for blocking and antibody dilution. They reported that the antibody worked very well in their western blotting experiments. Overall, the feedback is positive, highlighting reliable performance under standard WB conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Eiko (Verified Customer) (12-02-2020) | This UBC9 mouse monoclonal antibody worked very well in my western blotting. For blocking & dilution of antibody, I used 5% skim milk TBS-T.
|
