UBC9 Monoclonal antibody, PBS Only

UBC9 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 60201-1-PBS
Clone No.4A10B11

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

UBE2I, 4A10B11, C358B7.1, E2,UBE2I, EC:2.3.2.-

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60201-1-PBS targets UBC9 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7885

Product name: Recombinant human UBC9 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-184 aa of BC004437

Sequence: VPGTLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYWLVAALAPLVAAPPRPSQGRLAGREWSTQAHPRDSQGPRLC

Predict reactive species
Full Name ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast)
Calculated Molecular Weight 18 kDa
Observed Molecular Weight 18 kDa
GenBank Accession NumberBC004437
Gene Symbol UBC9
Gene ID (NCBI) 7329
RRIDAB_10918977
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP63279
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

UBC9 is also named as UBE2I, UBCE9 and belongs to the ubiquitin-conjugating enzyme family. It is a homologue of the E2 ubiquitin conjugating enzyme and participates in the covalent linking of SUMO-1 molecule to the target protein. This protein is present at a high level in spleen and lung. Moderate level of UBC9 is detected in kidney and liver. Low amount of UBC9 is observed in brain, whereas the 18 kDa band of UBC9 is barely visible or absent in heart and skeletal muscle. In heart and muscle extracts the UBC9 antibodies recognizes a 38 kDa protein band,but this band is not visible in extracts of other rat tissues(PMID:14739995).

Loading...
||
New chat Able
正在加载,请稍候...