Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

PRDX4 Monoclonal antibody

PRDX4 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 60286-1-Ig
Clone No. 5B6F1
Publications (5)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Antioxidant enzyme AOE372, AOE37 2, AOE37-2, EC:1.11.1.24, peroxiredoxin 4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for PRDX4 in ?

Tested Applications

Positive WB detected inLNCaP cells, NIH/3T3 cells, HeLa cells, HepG2 cells, K-562 cells, PC-12 cells, HEK-293 cells, Jurkat cells, HSC-T6 cells
Positive IHC detected inhuman colon tissue, human pancreas cancer tissue, human prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60286-1-Ig targets PRDX4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13401

Product name: Recombinant human PRDX4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-271 aa of BC007107

Sequence: MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

Predict reactive species
Full Name peroxiredoxin 4
Calculated Molecular Weight 31 kDa
Observed Molecular Weight 30 kDa
GenBank Accession NumberBC007107
Gene Symbol PRDX4
Gene ID (NCBI) 10549
RRIDAB_2881403
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13162
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRDX4(Peroxiredoxin-4) is also named as AOE37-2, Prx-IV and belongs to the AhpC/TSA family. PRDX4 is associated with acrosome formation during rat spermatogenesis and has a protective role in the male reproductive tract, because the phenotype of mice lacking this isoform includes testicular atrophy and increased sperm DNA damage(PMID:20864641). It is initially synthesized as a membrane-binding 31-kDa protein and processed into a 27-kDa secretory form and is discarded with the residual bodies(PMID:19208552). PRDX4 is a pentamer of dimers(PMID:23025503).

Protocols

Product Specific Protocols
IF protocol for PRDX4 antibody 60286-1-IgDownload protocol
IHC protocol for PRDX4 antibody 60286-1-IgDownload protocol
WB protocol for PRDX4 antibody 60286-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Peroxiredoxin 4 antibody (Cat# 60286-1-Ig) has 5 total citations across five journals: Nature Communications, Biomolecules, European Journal of Cell Biology, Biochemical and Biophysical Research Communications, and Clinical, Cosmetic and Investigational Dentistry. Associated research fields include multiple myeloma and proteasome inhibitor sensitivity, hepatocellular carcinoma macrophage polarization, endoplasmic reticulum stress and ROS regulation, oocyte maturation, and mitochondrial dysfunction in periodontitis. Applications cited are primarily WB and IF in human and mouse models.

SpeciesApplicationTitle
humanWB

Nat Commun

The deubiquitinase OTUD1 regulates immunoglobulin production and proteasome inhibitor sensitivity in multiple myeloma

Authors - Alexander Vdovin
  • KD Validated
mouseWB

Biomolecules

Exosome-Related FTCD Facilitates M1 Macrophage Polarization and Impacts the Prognosis of Hepatocellular Carcinoma

Authors - Youyi Liu
mouseWB

Eur J Cell Biol

Nrf2 maintains reactive oxygen species at an optimal level during endoplasmic reticulum stress in HT22 cells.

Authors - Yoko Hirata
mouseIF

Biochem Biophys Res Commun

Peroxiredoxin 4 secreted by cumulus cells ameliorates the maturation of oocytes in vitro

Authors - Wangjuan Dai
mouse,humanIF

Clin Cosmet Investig Dent

Integrative MultiOmics and Machine Learning Reveal Peroxiredoxin 4 as a Critical Hub Governing Mitochondrial Dysfunction and B Cell Differentiation in Periodontitis.

Authors - Congyi Tu
Loading...
||
New chat

Able™

正在加载,请稍候...