• Featured Product
  • KD/KO Validated

BSAP,PAX5 Monoclonal antibody

BSAP,PAX5 Monoclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 60349-1-Ig
Clone No.2H2D6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF, FC (Intra), IP, ELISA

PAX5, 2H2D6, B-cell-specific transcription factor, paired box 5, Paired box protein Pax 5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRamos cells, Daudi cells, Raji cells
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inRamos cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60349-1-Ig targets BSAP,PAX5 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16023

Product name: Recombinant human BSAP,PAX5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 145-391 aa of BC156927

Sequence: QPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAAATAYDRH

Predict reactive species
Full Name paired box 5
Calculated Molecular Weight 391 aa, 42 kDa
Observed Molecular Weight 42 kDa
GenBank Accession NumberBC156927
Gene Symbol PAX5
Gene ID (NCBI) 5079
RRIDAB_2881458
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ02548
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PAX5, also named B-cell specific activator protein (BSAP), is a member of the highly conserved paired box (PAX)-domain family of transcription factors. PAX5 is essential in normal B-cell lymphopoiesis. It is expressed in pro-B, pre-B and mature B lymphocytes but not in plasma cells. PAX5 is a common target in leukemogenesis of B-ALL ( B-lineage acute lymphoblastic leukemia) along with CDKN2A. Owing to its frequent deletion in B-ALL, PAX5 could be used as one of the molecular markers in diagnosis and monitoring of the disease. This antibody is specific to PAX5. It will not cross react with other PAX members.

Protocols

Product Specific Protocols
IHC protocol for BSAP,PAX5 antibody 60349-1-IgDownload protocol
WB protocol for BSAP,PAX5 antibody 60349-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IP,IHC,IF

Cell Death Dis

The MBNL1/circNTRK2/PAX5 pathway regulates aerobic glycolysis in glioblastoma cells by encoding a novel protein NTRK2-243aa

Authors - Yubo Zhao
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Kenzo (Verified Customer) (03-28-2024)

This antibody reacted mouse lymphocytes in tonsil and worked well for immunolabeling.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Tonsil
Loading...
||
New chat Able
正在加载,请稍候...