Able AI
What's the best dilution for GLP1R in ?
Product Information
60931-2-Ig targets GLP1R in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23529 Product name: Recombinant human GLP1R protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 26-145 aa of BC112126 Sequence: QGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY Predict reactive species |
| Full Name | glucagon-like peptide 1 receptor |
| Calculated Molecular Weight | 463 aa, 53 kDa |
| GenBank Accession Number | BC112126 |
| Gene Symbol | GLP1R |
| Gene ID (NCBI) | 2740 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P43220 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
