Tested Applications
| Positive WB detected in | Hela cells |
| Positive IHC detected in | human breast cancer tissue, human renal cell carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HUVEC cells, MCF-7 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66050-1-Ig targets NDUFA4L2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9233 Product name: Recombinant human NDUFA4L2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-87 aa of BC011910 Sequence: MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF Predict reactive species |
| Full Name | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4-like 2 |
| Calculated Molecular Weight | 87 aa, 10 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC011910 |
| Gene Symbol | NDUFA4L2 |
| Gene ID (NCBI) | 56901 |
| RRID | AB_11045656 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NRX3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NDUFA4L2, also named as NUOMS, is a HIF-1α target gene that localizes to the mitochondria. It downregulates oxygen consumption and Complex I activity in hypoxia. NDUFA4L2 is involved in hypoxic adaptation by decreasing mitochondrial ROS production.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NDUFA4L2 antibody 66050-1-Ig | Download protocol |
| IHC protocol for NDUFA4L2 antibody 66050-1-Ig | Download protocol |
| WB protocol for NDUFA4L2 antibody 66050-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NDUFA4L2 Monoclonal antibody (1G1H10), catalog number 66050-1-Ig, has 2 total citations. These appear in Cancer Biology & Therapy and eLife. The associated research fields include clear cell renal cell carcinoma (mitochondrial respiration and lysosomal trafficking) and pheochromocytoma (molecular classification and tumor microenvironment characteristics). Both studies used the antibody in human samples via WB and IHC applications.
| Species | Application | Title |
|---|---|---|
Cancer Biol Ther NDUFA4L2 reduces mitochondrial respiration resulting in defective lysosomal trafficking in clear cell renal cell carcinoma | ||
Elife Molecular classification and tumor microenvironment characteristics in pheochromocytomas |
Reviews
What customers say
Both reviews rated the antibody 5 stars. One user performed immunofluorescence on RCC4 cells at a 1:200 dilution, observing clear mitochondrial localization of NDUFA4L2 with minimal background. The other used the antibody for Western blot at 1:1000 on hypoxic mouse kidney tissue, reporting a specific band with an additional Ndufa4 signal and a hypoxic marker (Car9) above 25 kDa. Overall, reviewers highlight strong specificity and reliable performance across applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Kristian (Verified Customer) (06-07-2021) | The cells were stained with anti-NDUFA4l2 (green), Phalloidin (purple), and DAPI (blue). The NDUFA4L2 is localized in the mitochondria of the RCC4 cells.
 |
Daniel (Verified Customer) (04-16-2019) | Specific band in hypoxic mouse kidney. Additional band for Ndufa4.Note: The upper part of the blot (>25 kDa) was stained for a hypoxic marker (Car9).
 |
