Tested Applications
| Positive WB detected in | HSC-T6 cells, HeLa cells, HEK-293 cells, ROS1728 cells, NIH/3T3 cells, 4T1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66068-1-Ig targets SRP9 in WB, ELISA applications and shows reactivity with human, rat, mouse samples.
| Tested Reactivity | human, rat, mouse |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17153 Product name: Recombinant human SRP9 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-86 aa of BC015094 Sequence: MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE Predict reactive species |
| Full Name | signal recognition particle 9kDa |
| Calculated Molecular Weight | 10 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC015094 |
| Gene Symbol | SRP9 |
| Gene ID (NCBI) | 6726 |
| RRID | AB_11042618 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P49458 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Signal recognition particle 9(SRP9) is component of the signal recognition particle (SRP), which is a ribonucleoprotein complex that mediates the targeting of proteins to the rough endoplasmic reticulum (ER). SRP9 form a heterodimer with SRP14, which involves in arrest of the elongation of the nescent chains during targeting to ensure efficient translocation of the preprotein.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SRP9 antibody 66068-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SRP9 Monoclonal antibody (1H7G10), catalog number 66068-1-Ig, has a total of 2 citations. Both citations appear in Nucleic Acids Research and bioRxiv, published in 2024 by John B Moldovan et al. The research focuses on variable patterns of retrotransposition in different HeLa strains and mechanistic insights into SINE RNA mobilization processes. The antibody was used for Western blot (WB) applications in human samples.
| Species | Application | Title |
|---|---|---|
Nucleic Acids Res Variable patterns of retrotransposition in different HeLa strains provide mechanistic insights into SINE RNA mobilization processes | ||
bioRxiv Variable patterns of retrotransposition in different HeLa strains provide mechanistic insights into SINE RNA mobilization processes |
