• Featured Product
  • KD/KO Validated

TIMM44 Monoclonal antibody

TIMM44 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 66149-1-Ig
Clone No.4G7D4

Host / Isotype

Mouse / IgG2c

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF/ICC, ELISA

4G7D4, MIMT44, TIM44, TIMM 44

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, pig heart tissue, rabbit heart tissue
Positive IHC detected inhuman liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66149-1-Ig targets TIMM44 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG2c
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21389

Product name: Recombinant human TIMM44 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 153-452 aa of BC033628

Sequence: AKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKFKEEKVFEPNEEALGVVLHKDSKWYQQWKDFKENNVVFNRFFEMKMKYDESDNAFIRASRALTDKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATYSQLAHPIQQAKALGLQFHSRILDIDNVDLAMGKMMEQGPVLIITFQAQLVMVVRNPKGEVVEGDPDKVLRMLYVWALCRDQDELNPYAAWRLLDISASSTEQIL

Predict reactive species
Full Name translocase of inner mitochondrial membrane 44 homolog (yeast)
Calculated Molecular Weight 452 aa, 51 kDa
Observed Molecular Weight 45 kDa
GenBank Accession NumberBC033628
Gene Symbol TIMM44
Gene ID (NCBI) 10469
RRIDAB_2881545
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO43615
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Translocase of inner mitochondrial membrane 44 (TIMM44), also known as MIMT44 and TIM44, belongs to the Tim44 family. TIMM44 is a mitochondrial protein located at the inner mitochondrial membrane, which is crucial for the integrity and function of mitochondria. In an ATP-dependent manner, TIMM44 anchors mitochondrial heat shock protein 70 to the translocase of the mitochondrial inner membrane 23 (TIMM23) complex. TIMM44 is essential for mitochondrial pre-protein import into the mitochondrial matrix. TIMM44 is vital for the integrity and function of mitochondria. TIMM44 silencing disrupted mitochondrial functions in endothelial cells, causing mitochondrial protein input arrest, ATP reduction, ROS production, and mitochondrial depolarization, and leading to apoptosis activation (PMID: 36438483, PMID: 37147302, PMID: 38467612). The observed molecular weight of TIMM44 is 45 kDa, indicating a mature form of TIMM44 (PMID: 33891006).

Protocols

Product Specific Protocols
WB protocol for TIMM44 antibody 66149-1-IgDownload protocol
IHC protocol for TIMM44 antibody 66149-1-IgDownload protocol
IF protocol for TIMM44 antibody 66149-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Lana (Verified Customer) (04-20-2019)

SDS-PAGE:15 ug/ul RIPA lysate of mitochondrial fraction of ST-Hdh-Q7/Q7 mouse striatal cell line4-12% Bis-tris gradient gelTransfer:Immobilon-FL transfer membranes (Millipore), O/N at 30V, 4CBlocking:SEA Block Blocking Buffer 1hPrimary Ab:O/N incubation at 4CSecondary Ab:IRDye 800CW Goat anti-Mouse1 h incubation at room temperatureLines on WB:1. BioRad Precision Plus Protein standards2. Lysate of mitochondrial fraction of ST-Hdh-Q7/Q7 mouse striatal cell line

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: ST-Hdh mouse striatal cell line
TIMM44 Antibody Western Blot, validation (1:1000 dilution) in ST-Hdh mouse striatal cell line (Cat no:66149-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...