Tested Applications
| Positive WB detected in | HUVEC cells, human blood, human plasma, HepG2 cells, J774A.1 cells, RAW 264.7 cells |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66157-1-Ig targets C3/C3b/C3c in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15955 Product name: Recombinant human C3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1314-1663 aa of BC150179 Sequence: ESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN Predict reactive species |
| Full Name | complement component 3 |
| Calculated Molecular Weight | 1663 aa, 187 kDa |
| Observed Molecular Weight | 115 kDa |
| GenBank Accession Number | BC150179 |
| Gene Symbol | C3 |
| Gene ID (NCBI) | 718 |
| RRID | AB_2881553 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P01024 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The complement system is an important effector that bridges the innate and adaptive immune systems (PMID: 20010915). The third component of complement, C3, plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways (PMID: 11414361). Human C3, composed of α and β chains (115 and 75 kDa, respectively), is cleaved into C3a and C3b by C3 convertase. C3b is further cleaved into iC3b, C3c, C3dg and C3f. This antibody raised against 1314-1663 aa of human C3 protein recognizes the C3 alpha chain, C3b alpha' chain, and C3c alpha' chain fragment 2.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for C3/C3b/C3c antibody 66157-1-Ig | Download protocol |
| IHC protocol for C3/C3b/C3c antibody 66157-1-Ig | Download protocol |
| WB protocol for C3/C3b/C3c antibody 66157-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The C3/C3b/C3c Monoclonal antibody (Cat# 66157-1-Ig) has 26 citations. Journals include ACS Nano, EBioMedicine, J Neuroinflammation, Free Radic Biol Med, Brain Behav Immun, Cell Rep, Virulence, Int J Mol Sci, Glia, Clin Kidney J, and others. Research fields span neuroinflammation, spinal cord injury, complement-mediated synaptic pruning, Parkinson's disease, depression, ischemia-reperfusion injury, infectious disease, cardiovascular disease, and autoimmune conditions, with applications mainly in WB and IF.
| Species | Application | Title |
|---|---|---|
Int J Oral Sci Author Correction: Fibroblast derived C3 promotes the progression of experimental periodontitis through macrophage M1 polarization and osteoclast differentiation | ||
Int J Oral Sci Fibroblast derived C3 promotes the progression of experimental periodontitis through macrophage M1 polarization and osteoclast differentiation | ||
ACS Nano Nanoparticle-Assembled Multifaceted Hydrogel Therapy Promotes Functional Recovery After Spinal Cord Injury. | ||
J Neuroinflammation Regulatory T cells promote microglia-mediated synapse engulfment and functional recovery via the OPN-CD74 axis after spinal cord injury in mice. | ||
J Neuroinflammation Apelin alleviated neuroinflammation and promoted endogenous neural stem cell proliferation and differentiation after spinal cord injury in rats. | ||
EBioMedicine The complement C3-microglial axis in depression of Parkinson's disease: from mechanism to therapeutic intervention. |
Reviews
What customers say
Users report positive results with this antibody across applications. One reviewer used it for immunofluorescence on rat kidney tissue at 1/200 dilution in an LPS induction model, providing a detailed protocol with paraformaldehyde fixation and Triton X-100 permeabilization. Another reviewer used it for Western Blot on synovial fluid at 1:4000 dilution, describing the bands as clear and distinct, and recommending it for C3 identification. Overall, the antibody performs well in both IF and WB with strong signal quality.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Marion (Verified Customer) (08-01-2024) | LPS induction model Fixative: Paraformaldehyde 4% Permeabilization: 10 min; RT; 0.2% Triton X-100 Blocking: 2 h; RT; 10% Normal donkey serum; 1% BSA Primary antibody: 1 night; 4°C Secondary antibody: ab150112 (Abcam); 1h30; RT Antibodies diluted in blocking solution
 |
Neil (Verified Customer) (05-10-2019) | The Western Blot came out spectacularly! I saw the bands I expected to see, and everything was clear and distinct. I would recommend this to anyone looking to identify C3.
|
