Haptoglobin Monoclonal antibody

Haptoglobin Monoclonal Antibody for WB, IHC, ELISA
Cat No. 66229-1-Ig
Clone No.3B4B9

Host / Isotype

Mouse / IgG2b

Reactivity

human, pig and More (1)

Applications

WB, IHC, ELISA

BP, HAPT, haptoglobin, HP, HP2 ALPHA 2, HPA1S, Zonulin

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman plasma tissue
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:20000
Immunohistochemistry (IHC)IHC : 1:4000-1:16000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

66229-1-Ig targets Haptoglobin in WB, IHC, ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Cited Reactivitymonkey
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9927

Product name: Recombinant human HP protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 179-406 aa of BC058031

Sequence: MVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN

Predict reactive species
Full Name haptoglobin
Calculated Molecular Weight281aa,31 kDa; 228aa,25 kDa
Observed Molecular Weight 42 kDa
GenBank Accession NumberBC058031
Gene Symbol HP
Gene ID (NCBI) 3240
RRIDAB_2881620
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP00738
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HP(Haptoglobin) is also named as zonulin and belongs to the peptidase S1 family. HP, a plasma glycoprotein that binds free hemoglobin, has a tetrameric structure of 2 alpha(16 kDa and 9 kDa) and 2 beta(40 kDa) polypeptides that are covalently associated by disulfide bonds. In most species, apart from ruminants, Hp has a molecular mass of 100 kDa, consisting of two subunits of 40 kDa and two subunits of 9 kDa, although in a few species, such as man, genetic variant of Hp forms polymers of higher mass(PMID:2361363). Recent studies of haptoglobin show that certain oligosaccharide structures predominate in different diseases. For example, a highly-fucosylated structure is found in breast cancer and ovarian cancer, highly-sialylated structures in Crohn’s disease and highly branched structures in alcoholic liver disease and fucosylated haptoglobin is a good serum marker for pancreatic cancer.(PMID:16385567).

Protocols

Product Specific Protocols
WB protocol for Haptoglobin antibody 66229-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
monkeyWB

Int J Radiat Oncol Biol Phys

Identification of Novel Biomarkers for Acute Radiation Injury Using Multiomics Approach and Nonhuman Primate Model

Authors - Amrita K Cheema
Loading...
||
New chat Able
正在加载,请稍候...