Use Able AI chat for product recommendations

Haptoglobin Monoclonal antibody, PBS Only

Haptoglobin Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66229-1-PBS
Clone No.3B4B9

Host / Isotype

Mouse / IgG2b

Reactivity

human, pig

Applications

WB, IHC, Indirect ELISA

BP, HAPT, haptoglobin, HP, HP2 ALPHA 2, HPA1S, Zonulin

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66229-1-PBS targets Haptoglobin in WB, IHC, Indirect ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9927

Product name: Recombinant human HP protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 179-406 aa of BC058031

Sequence: MVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN

Predict reactive species
Full Name haptoglobin
Calculated Molecular Weight281aa,31 kDa; 228aa,25 kDa
Observed Molecular Weight 42 kDa
GenBank Accession NumberBC058031
Gene Symbol HP
Gene ID (NCBI) 3240
RRIDAB_2881620
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP00738
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

HP(Haptoglobin) is also named as zonulin and belongs to the peptidase S1 family. HP, a plasma glycoprotein that binds free hemoglobin, has a tetrameric structure of 2 alpha(16 kDa and 9 kDa) and 2 beta(40 kDa) polypeptides that are covalently associated by disulfide bonds. In most species, apart from ruminants, Hp has a molecular mass of 100 kDa, consisting of two subunits of 40 kDa and two subunits of 9 kDa, although in a few species, such as man, genetic variant of Hp forms polymers of higher mass(PMID:2361363). Recent studies of haptoglobin show that certain oligosaccharide structures predominate in different diseases. For example, a highly-fucosylated structure is found in breast cancer and ovarian cancer, highly-sialylated structures in Crohn’s disease and highly branched structures in alcoholic liver disease and fucosylated haptoglobin is a good serum marker for pancreatic cancer.(PMID:16385567).

Loading...
||
New chat

Able

正在加载,请稍候...