Haptoglobin Monoclonal antibody, PBS Only

• 

  WB analysis of human plasma using 66229-1-Ig (same clone as 66229-1-PBS)

  0.5 μl human plasma was subjected to SDS PAGE followed by western blot with 66229-1-Ig (HP Antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66229-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66229-1-Ig (same clone as 66229-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66229-1-Ig (Haptoglobin antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66229-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66229-1-Ig (same clone as 66229-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66229-1-Ig (Haptoglobin antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66229-1-PBS in a different storage buffer formulation.

Haptoglobin Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66229-1-PBS

Clone No.3B4B9

Host / Isotype

Mouse / IgG2b

Reactivity

human, pig

Applications

WB, IHC, Indirect ELISA

Synonyms

BP, HAPT, haptoglobin, HP, HP2 ALPHA 2, HPA1S, Zonulin

---

Product Information

66229-1-PBS targets Haptoglobin in WB, IHC, Indirect ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9927

  Product name: Recombinant human HP protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 179-406 aa of BC058031

  Sequence: MVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN

• Full Name: haptoglobin
• Calculated Molecular Weight: 281aa,31 kDa; 228aa,25 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC058031
• Gene Symbol: HP
• Gene ID (NCBI): 3240
• RRID: AB_2881620
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P00738
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HP(Haptoglobin) is also named as zonulin and belongs to the peptidase S1 family. HP, a plasma glycoprotein that binds free hemoglobin, has a tetrameric structure of 2 alpha(16 kDa and 9 kDa) and 2 beta(40 kDa) polypeptides that are covalently associated by disulfide bonds. In most species, apart from ruminants, Hp has a molecular mass of 100 kDa, consisting of two subunits of 40 kDa and two subunits of 9 kDa, although in a few species, such as man, genetic variant of Hp forms polymers of higher mass(PMID:2361363). Recent studies of haptoglobin show that certain oligosaccharide structures predominate in different diseases. For example, a highly-fucosylated structure is found in breast cancer and ovarian cancer, highly-sialylated structures in Crohn’s disease and highly branched structures in alcoholic liver disease and fucosylated haptoglobin is a good serum marker for pancreatic cancer.(PMID:16385567).