Tested Applications
| Positive WB detected in | HeLa cells, Jurkat cells, HEK-293 cells, pig heart tissue, human heart tissue, K-562 cells, HSC-T6 cells, RAW 264.7 cells, MCF-7 cells |
| Positive IHC detected in | human lung cancer tissue, human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66234-1-Ig targets p38 MAPK in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5797 Product name: Recombinant human p38 MAPK protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-307 aa of BC031574 Sequence: MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAY Predict reactive species |
| Full Name | mitogen-activated protein kinase 14 |
| Calculated Molecular Weight | 360 aa, 41 kDa |
| Observed Molecular Weight | 38-42 kDa |
| GenBank Accession Number | BC031574 |
| Gene Symbol | p38 MAPK |
| Gene ID (NCBI) | 1432 |
| RRID | AB_2861335 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q16539 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MAPK14(mitogen-activated protein kinase 14) is also named as SAPK2A, p38MAPK, CSBP1, RK, p38, EXIP, Mxi2, CSBP2, PRKM14, PRKM15, CSPB1, p38ALPHA and belongs to the MAP kinase subfamily. MAPK14-signaling is a central pathway for the integration of instructive signals in dendritic cells for T(H)17 differentiation and inflammation(PMID:22231518). It plays an important role in the regulation of hematopoietic stem cell self-renewal in vitro and inhibition of MAPK14 activation with a small molecule inhibitor may represent a novel approach to promote ex vivo expansion of hematopoietic stem cell(PMID:21198398). This protein has 4 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for p38 MAPK antibody 66234-1-Ig | Download protocol |
| IHC protocol for p38 MAPK antibody 66234-1-Ig | Download protocol |
| WB protocol for p38 MAPK antibody 66234-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The p38 MAPK Monoclonal antibody (Cat# 66234-1-Ig) has 135 citations across over 80 journals, including Theranostics, J Exp Clin Cancer Res, Adv Sci, Brain, Pharmacol Res, J Ethnopharmacol, Int J Mol Sci, and J Transl Med. Research fields encompass oncology (hepatocellular, breast, colorectal, and glioblastoma cancers), neuroinflammation, cardiology, diabetes, immunology, ferroptosis, toxicology, and traditional Chinese medicine pharmacology. The antibody is predominantly applied in Western blot across human, mouse, rat, and pig species.
| Species | Application | Title |
|---|---|---|
Clin Mol Hepatol Targeting TM4SF1 promotes tumor senescence enhancing CD8+ T cell cytotoxic function in hepatocellular carcinoma | ||
J Adv Res Maternal fish oil supplementation enhances placental nutrient transport and mammary gland secretion via the GPR120 signaling pathway | ||
Metabolism Ganoderic acid T, a novel activator of pyruvate carboxylase, exhibits potent anti-liver cancer activity | ||
J Nanobiotechnology PDLIM4 drives gastric cancer malignant progression and cisplatin resistance by inhibiting HSP70 ubiquitination and degradation via competitive interaction with STUB1. | ||
Theranostics Surface-cleaned black phosphorus nanosheets chelate iron and rebalance the ferroptosis-immune axis in acute kidney injury. | ||
Theranostics Pharmacological and genetic inhibition of ARG2 in CXCR2(Hi) myeloid-derived suppressor cells combats sepsis-induced lymphopenia. |
Reviews
What customers say
The single review for this product is negative, rated 1 star for Western Blot. The reviewer reported poor p38MAPK detection, with no visible bands at dilutions of 1:500 and 1:1000 in HaCaT cells. They noted that a different p38MAPK antibody on the same membrane produced clear, visible bands, suggesting this particular reagent underperformed in their experimental setup.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Karen (Verified Customer) (11-10-2022) | p38MAPK detection for WB is not good, no bands detectable with different dilutions (1:500 and 1:1000). The same membrane was incubated with another p38MAPK antibody and was nicely visible.
 |
