Able AI
What's the best dilution for CD74 in ?
Product Information
66390-2-Ig targets CD74 in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25503 Product name: Recombinant human CD74 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-48 aa of BC018726 Sequence: MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGA Predict reactive species |
| Full Name | CD74 molecule, major histocompatibility complex, class II invariant chain |
| Calculated Molecular Weight | 34 kDa |
| GenBank Accession Number | BC018726 |
| Gene Symbol | CD74 |
| Gene ID (NCBI) | 972 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A Magarose purification |
| UNIPROT ID | P04233 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
