Product Information
66390-2-PBS targets CD74 as part of a matched antibody pair:
MP50646-1: 66390-2-PBS capture and 66390-3-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25503 Product name: Recombinant human CD74 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-48 aa of BC018726 Sequence: MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGA Predict reactive species |
| Full Name | CD74 molecule, major histocompatibility complex, class II invariant chain |
| Calculated Molecular Weight | 34 kDa |
| GenBank Accession Number | BC018726 |
| Gene Symbol | CD74 |
| Gene ID (NCBI) | 972 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P04233 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



