• Featured Product
  • KD/KO Validated

S100A4 Monoclonal antibody

S100A4 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 66489-1-Ig
Clone No.2G11B4

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Fibroblast-specific protein-1, Fibroblast-specific protein 1, Fibroblast Specific Protein, CAPL, Calvasculin

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNK-92 cells, A375 cells, HeLa cells, PC-3 cells, THP-1 cells, A549 cells, NIH/3T3 cells, HSC-T6 cells
Positive IHC detected inhuman lung cancer tissue, human colon cancer tissue, human tonsillitis tissue, K-562 cells, mouse lung tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66489-1-Ig targets S100A4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9019

Product name: Recombinant human S100A4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-101 aa of BC016300

Sequence: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Predict reactive species
Full Name S100 calcium binding protein A4
Calculated Molecular Weight 101 aa, 12 kDa
Observed Molecular Weight 12 kDa
GenBank Accession NumberBC016300
Gene Symbol S100A4
Gene ID (NCBI) 6275
ENSEMBL Gene IDENSG00000196154
RRIDAB_2881854
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP26447
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

S100A4 is a member of the S100 family of calcium-binding proteins. The S100 family members have been involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A4 is known to localize to and function in the nucleus, cytoplasm of cells, and the extracellular space. S100A4 has also been shown to be associated with tumor growth, motility, invasion, metastasis, angiogenesis, apoptosis, and chemoresistance. It is a fibroblast-specific protein associated with mesenchymal cell morphology and motility, is expressed during epithelial-mesenchymal transformations (EMT) in vivo (PMID: 9362334). It is a specific prognostic marker for renal survival in patients with IgAN (PMID: 16105038). It is also an improved marker for lung fibroblasts that could be useful for investigating the pathogenesis of pulmonary fibrosis(PMID: 15618458). Overexpression of S100A4 is correlated with a worse prognosis inpatients with various types of cancer.

Protocols

Product Specific Protocols
WB protocol for S100A4 antibody 66489-1-IgDownload protocol
IHC protocol for S100A4 antibody 66489-1-IgDownload protocol
IF protocol for S100A4 antibody 66489-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Blood

C1Q labels a highly aggressive macrophage-like leukemia population indicating extramedullary infiltration and relapse

Authors - Li-Xue Yang
human,mouseIHC,IF

Adv Sci (Weinh)

Meis1 Targets Protein Tyrosine Phosphatase Receptor J in Fibroblast to Retard Chronic Kidney Disease Progression

Authors - Mi Bai
mouseIHC

Cell Death Differ

Upregulation of Wilms' Tumor 1 in epicardial cells increases cardiac fibrosis in dystrophic mice.

Authors - Zhenglong Guo
mouseWB,IF

Acta Pharmacol Sin

PU.1/Spi1 exacerbates ischemia-reperfusion induced acute kidney injury via upregulating Gata2 and promoting fibroblast activation

Authors - Chen Zong
mouseIF,FC

PLoS Pathog

S100A4+ macrophages facilitate zika virus invasion and persistence in the seminiferous tubules via interferon-gamma mediation.

Authors - Wei Yang
mouseWB

Cancers (Basel)

Usp22 Overexpression Leads to Aberrant Signal Transduction of Cancer-Related Pathways but Is Not Sufficient to Drive Tumor Formation in Mice

Authors - Xianghong Kuang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

CAITLIN (Verified Customer) (03-04-2025)

Worked great, highly specific even when used at higher dilution than recommended

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: A2780
FH

Caitlin (Verified Customer) (10-15-2024)

Works well, very convenient that the antibody can be used at such high dilutions and still achieve band specificity!

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:50000
  • Cell Tissue Type: A2780
FH

Shinford (Verified Customer) (10-26-2023)

I have some reservations about the antibody because of its relatively low molecular weight. We attempted to create separate gels with 10% and 12% concentrations and made an effort to run the gels for a limited time to ensure that the entire protein remained within the original gels and membranes. While we were able to detect several bands, their positions lower in the gel led to less than ideal band shapes.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Lung cancer and breast cancer cell lines
S100A4 Antibody Western Blot validation (1:500 dilution) in Lung cancer and breast cancer cell lines (Cat no:66489-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...