• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated S100A4 Monoclonal antibody

S100A4 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL647-66489
Clone No.2G11B4

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

2G11B4, Calvasculin, CAPL, Fibroblast Specific Protein, Fibroblast-specific protein 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-66489 targets S100A4 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9019

Product name: Recombinant human S100A4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-101 aa of BC016300

Sequence: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Predict reactive species
Full Name S100 calcium binding protein A4
Calculated Molecular Weight 101 aa, 12 kDa
Observed Molecular Weight 12 kDa
GenBank Accession NumberBC016300
Gene Symbol S100A4
Gene ID (NCBI) 6275
ENSEMBL Gene IDENSG00000196154
RRIDAB_3673640
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP26447
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

S100A4 is a member of the S100 family of calcium-binding proteins. The S100 family members have been involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A4 is known to localize to and function in the nucleus, cytoplasm of cells, and the extracellular space. S100A4 has also been shown to be associated with tumor growth, motility, invasion, metastasis, angiogenesis, apoptosis, and chemoresistance. It is a fibroblast-specific protein associated with mesenchymal cell morphology and motility, is expressed during epithelial-mesenchymal transformations (EMT) in vivo (PMID: 9362334). It is a specific prognostic marker for renal survival in patients with IgAN (PMID: 16105038). It is also an improved marker for lung fibroblasts that could be useful for investigating the pathogenesis of pulmonary fibrosis(PMID: 15618458). Overexpression of S100A4 is correlated with a worse prognosis inpatients with various types of cancer.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 S100A4 antibody CL647-66489Download protocol
IF protocol for CL Plus 647 S100A4 antibody CL647-66489Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...