• Featured Product
  • KD/KO Validated

CD151 Monoclonal antibody, PBS Only (Capture)

CD151 Monoclonal Antibody for WB, IHC, IF-P, IP, Cytometric bead array, Indirect ELISA
Cat No. 66567-1-PBS
Clone No.2A8G8

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, IF-P, IP, Cytometric bead array, Indirect ELISA

2A8G8, CD151 antigen, GP27, Membrane glycoprotein SFA 1, Membrane glycoprotein SFA-1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66567-1-PBS targets CD151 as part of a matched antibody pair:

MP50304-1: 66567-1-PBS capture and 66567-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25985

Product name: Recombinant human CD151 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 113-221 aa of BC001374

Sequence: AYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR

Predict reactive species
Full Name CD151 molecule (Raph blood group)
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 28 kDa
GenBank Accession NumberBC001374
Gene Symbol CD151
Gene ID (NCBI) 977
RRIDAB_2881928
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP48509
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD151 (also known as TSPAN24) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are involved in the regulation of cell development, activation, growth and motility. CD151 is broadly expressed by a variety of cell types. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. CD151 enhances cell motility, invasion and metastasis of cancer cells.

Loading...
||
New chat Able
正在加载,请稍候...