Tested Applications
| Positive WB detected in | HEK-293 cells, pig brain tissue, HeLa cells, HepG2 cells, Y79 cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66583-1-Ig targets OPA1 in WB, IHC, IF, ELISA applications and shows reactivity with Human, mouse, pig, rat samples.
| Tested Reactivity | Human, mouse, pig, rat |
| Cited Reactivity | human, mouse, rat, fish |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26868 Product name: Recombinant human OPA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 650-780 aa of BC075805 Sequence: NTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAIYFMEEALQARLKDTENAIENMVGPDWKKRWLYWKN Predict reactive species |
| Full Name | optic atrophy 1 (autosomal dominant) |
| Calculated Molecular Weight | 960 aa, 112 kDa |
| Observed Molecular Weight | 100 kDa and 80-90 kDa |
| GenBank Accession Number | BC075805 |
| Gene Symbol | OPA1 |
| Gene ID (NCBI) | 4976 |
| RRID | AB_2881943 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O60313 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
OPA1 is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. OPA1 localizes to the inner mitochondrial membrane and helps regulate mitochondrial stability and energy output. This protein also sequesters cytochrome c. OPA1 is associated with the inner membrane and protects cells from apoptosis by regulating inner membrane dynamics. Mutation of OPA1 causes the disease dominant optic atrophy, a degeneration of the retinal ganglion cells. OPA1 undergoes complex posttranscriptional regulation and posttranslational proteolysis. OPA1 is regulated by proteolytic cleavage, which degrades long OPA1 isoforms into short isoforms. The gene OPA1 can be cleaved into some chains with MW 100 kDa and 80-90 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for OPA1 antibody 66583-1-Ig | Download protocol |
| WB protocol for OPA1 antibody 66583-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-OPA1 antibody (Cat# 66583-1-Ig) has accumulated 32 citations across 29 journals, including Advanced Science, Oncogene, Small, Cell Death & Disease, Free Radical Biology and Medicine, and Stem Cell Research & Therapy. Research fields span mitochondrial dynamics, apoptosis, ferroptosis, cardiac injury, neurodegeneration, diabetes, bone metabolism, ovarian dysfunction, liver disease, and cancer.
| Species | Application | Title |
|---|---|---|
J Nanobiotechnology Human periodontal ligament stem cell sheets activated by graphene oxide quantum dots repair periodontal bone defects by promoting mitochondrial dynamics dependent osteogenic differentiation | ||
Genes Dis TNFα-reliant FSP1 up-regulation promotes intervertebral disc degeneration via caspase 3-dependent apoptosis | ||
Adv Sci (Weinh) Ubiquitination of ACSL4 by Parkin Suppresses Ferroptosis and Rescues Glucocorticoid-Induced Bone Loss | ||
Adv Sci (Weinh) HIGD1A Alleviates Oxidative Stress Related Ovarian Hypofunction by Enhancing Granulosa Cell Functions via NF-κB/SOD2 Signaling Pathway | ||
Cell Death Dis Cadmium-induced apoptosis of Leydig cells is mediated by excessive mitochondrial fission and inhibition of mitophagy | ||
Reviews
What customers say
The product has one user review. Pierre Duquesne rated it 5 stars in September 2025, describing the antibody as "Excellent." He used it for Western Blot on T cells (lot 10005480). Overall, the feedback is positive, indicating reliable performance in WB applications for T cell research.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Pierre (Verified Customer) (09-26-2025) | Excellent
|
