Tested Applications
| Positive WB detected in | HepG2 cells, DC2.4 cells, HEK-293 cells |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66592-1-Ig targets RAF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25423 Product name: Recombinant human RAF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-59 aa of BC018119 Sequence: MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIR Predict reactive species |
| Full Name | v-raf-1 murine leukemia viral oncogene homolog 1 |
| Calculated Molecular Weight | 648 aa, 73 kDa |
| Observed Molecular Weight | 70-75 kDa |
| GenBank Accession Number | BC018119 |
| Gene Symbol | RAF1 |
| Gene ID (NCBI) | 5894 |
| RRID | AB_2881952 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P04049 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Raf-1 proto-oncogene, serine/threonine kinase(RAF1), is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. RAF1 has two isoforms with MW of 73, 75 kDa. RAF1 plays an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RAF1 antibody 66592-1-Ig | Download protocol |
| IHC protocol for RAF1 antibody 66592-1-Ig | Download protocol |
| WB protocol for RAF1 antibody 66592-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
66592-1-Ig is a RAF1 antibody with 23 total citations. Citations appear in journals including PNAS, Cell Death & Disease, Molecular Therapy, FASEB Journal, Journal of Experimental & Clinical Cancer Research, International Journal of Biological Sciences, and Scientific Reports. Research fields span oncology (hepatocellular, pancreatic, ovarian, colorectal, gastric, breast, thyroid, and lung cancers), ferroptosis, RAF/MEK/ERK and MAPK signaling, neuroinflammation, and energy metabolism.
| Species | Application | Title |
|---|---|---|
J Exp Clin Cancer Res Bufalin inhibits hepatocellular carcinoma progression by blocking EGFR-mediated RAS-RAF-MEK-ERK pathway activation | ||
Cell Mol Biol Lett Exosomal DNAJB11 promotes the development of pancreatic cancer by modulating the EGFR/MAPK pathway | ||
Cell Death Dis Oncogenic RTKs sensitize cancer cells to ferroptosis via c-Myc mediated upregulation of ACSL4
| ||
Int J Biol Sci Exosomal SLC16A1-AS1-induced M2 macrophages polarization facilitates hepatocellular carcinoma progression | ||
Mol Ther Pancreatic cancer-derived extracellular vesicles remodel the tumor microenvironment and enhance chemoresistance by delivering KRASG12D protein to cancer-associated fibroblasts | ||
NPJ Precis Oncol GLUD1 supports ovarian cancer progression by counteracting anoikis via ARAF/MEK/ERK signaling. |
