Tested Applications
| Positive WB detected in | HT-29 cells, Caco-2 cells |
| Positive IHC detected in | human kidney tissue, human breast cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse colon tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66666-1-Ig targets CD133 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13327 Product name: Recombinant human CD133 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 505-782 aa of BC012089 Sequence: LICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNKSKMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFLLGAAGRKNLQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPL Predict reactive species |
| Full Name | prominin 1 |
| Calculated Molecular Weight | 97 kDa |
| Observed Molecular Weight | 115 kDa, 80-90 kDa |
| GenBank Accession Number | BC012089 |
| Gene Symbol | CD133 |
| Gene ID (NCBI) | 8842 |
| RRID | AB_2801586 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O43490 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD133, also known as PROM1 (prominin-1) or AC133, belongs to the prominin family. CD133 is a transmembrane glycoprotein with an NH2-terminal extracellular domain, five transmembrane loops and a cytoplasmic tail. The expression of CD133 has been reported in hematopoietic stem cells, endothelial progenitor cells, neuronal and glial stem cells, suggesting the potential role of CD133 as a cell surface marker of adult stem cells. CD133 has also been reported as a marker of cancer stem cells in various human tumors. CD133 is a highly glycosylated protein with an apparent molecular weight of 115-120 kDa. After the treatment of the lysates with glycosidase, CD133 shifted to a protein with an apparent molecular weight of 80-90 kDa (PMID: 23150174; 20068153).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD133 antibody 66666-1-Ig | Download protocol |
| IHC protocol for CD133 antibody 66666-1-Ig | Download protocol |
| WB protocol for CD133 antibody 66666-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-CD133 antibody (Cat# 66666-1-Ig) has 85 citations published in journals including Cancer Research, J Exp Clin Cancer Res, Advanced Science, Cell Reports Medicine, Cell Death & Disease, Oncogene, EMBO Journal, Stem Cell Research & Therapy, Int J Mol Sci, and Front Cell Dev Biol. Research fields focus on cancer stem cell biology, stemness maintenance, and tumor progression across glioma, colorectal, pancreatic, hepatocellular, and breast cancers, primarily using WB, IF, and IHC applications.
| Species | Application | Title |
|---|---|---|
Cancer Res Targeting CD44 variant 5 with an antibody-drug conjugate is an effective therapeutic strategy for intrahepatic cholangiocarcinoma | ||
J Exp Clin Cancer Res ISG15 and ISGylation modulates cancer stem cell-like characteristics in promoting tumor growth of anaplastic thyroid carcinoma | ||
J Exp Clin Cancer Res Gemcitabine-induced β4 integrin drives cancer progression and gemcitabine resistance in pancreatic cancer. | ||
J Exp Clin Cancer Res Pharmacological targeting PTK6 inhibits the JAK2/STAT3 sustained stemness and reverses chemoresistance of colorectal cancer. | ||
Adv Sci (Weinh) SLPI⁺ AT2-Like Cells Orchestrate Lung Adenocarcinoma Invasion via Wnt Pathway Activation and Stromal Crosstalk in a Spatially Defined Margin Niche. | ||
Adv Sci (Weinh) CDKAL1 Drives the Maintenance of Cancer Stem-Like Cells by Assembling the eIF4F Translation Initiation Complex |
Reviews
What customers say
The single review for this product is highly positive, rated 5 out of 5. The reviewer used the antibody for Western Blot at a 1:1000 dilution on glioblastoma cells and reported that it worked well. Overall, the feedback confirms reliable performance in WB applications at the recommended dilution.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Udesh (Verified Customer) (08-16-2023) | Worked well in WB at 1:1000
|
