PSMA/GCPII Monoclonal antibody, PBS Only (Detector)

PSMA/GCPII Monoclonal Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA
Cat No. 66678-1-PBS
Clone No.3G4E12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

FOLH1, PSMA, 3G4E12, Cell growth-inhibiting gene 27 protein, EC:3.4.17.21

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66678-1-PBS targets PSMA/GCPII as part of a matched antibody pair:

MP51112-1: 66678-2-PBS capture and 66678-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16594

Product name: Recombinant human FOLH1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 45-385 aa of BC025672

Sequence: SSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGG

Predict reactive species
Full Name folate hydrolase (prostate-specific membrane antigen) 1
Calculated Molecular Weight 719 aa, 81 kDa
Observed Molecular Weight 100-120 kDa
GenBank Accession NumberBC025672
Gene Symbol PSMA
Gene ID (NCBI) 2346
RRIDAB_2882032
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ04609
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PSMA(Prostate-specific membrane antigen) is also named as FOLH1, FOLH, NAALAD1, PSM and belongs to the peptidase M28 family. PSMA is a 100-120 kDa integral transmembrane glycoprotein, considered to be a highly specific marker of the prostate gland, and has successfully been used as a marker of circulating prostatic epithelial cells(PMID:10074909; 15680901). It is involved in conversion of the major neurotransmitter (NAAG) to NAA and free glutamate. It has 8 isoforms produced by alternative splicing.

Loading...
||
New chat Able
正在加载,请稍候...