Tested Applications
| Positive WB detected in | rat kidney tissue, LNCaP cells, mouse kidney tissue, rat brain tissue, mouse brain tissue |
| Positive IHC detected in | human prostate cancer tissue, rat kidney tissue, human prostate hyperplasia tissue, human kidney tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human prostate cancer tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66678-1-Ig targets PSMA/GCPII in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16594 Product name: Recombinant human FOLH1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 45-385 aa of BC025672 Sequence: SSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGG Predict reactive species |
| Full Name | folate hydrolase (prostate-specific membrane antigen) 1 |
| Calculated Molecular Weight | 719 aa, 81 kDa |
| Observed Molecular Weight | 100-120 kDa |
| GenBank Accession Number | BC025672 |
| Gene Symbol | PSMA |
| Gene ID (NCBI) | 2346 |
| RRID | AB_2882032 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q04609 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PSMA(Prostate-specific membrane antigen) is also named as FOLH1, FOLH, NAALAD1, PSM and belongs to the peptidase M28 family. PSMA is a 100-120 kDa integral transmembrane glycoprotein, considered to be a highly specific marker of the prostate gland, and has successfully been used as a marker of circulating prostatic epithelial cells(PMID:10074909; 15680901). It is involved in conversion of the major neurotransmitter (NAAG) to NAA and free glutamate. It has 8 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PSMA/GCPII antibody 66678-1-Ig | Download protocol |
| IHC protocol for PSMA/GCPII antibody 66678-1-Ig | Download protocol |
| WB protocol for PSMA/GCPII antibody 66678-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PSMA antibody (Cat# 66678-1-Ig) has 6 total citations published in Mol Cancer, Biosens Bioelectron, J Med Chem, Sci Rep, RSC Med Chem, and Am J Clin Exp Urol. Research fields include prostate cancer biology, PSMA-targeted drug design, cancer exosome detection, and neuroendocrine differentiation of cancer cells. Applications span WB and IHC in human and mouse models.
| Species | Application | Title |
|---|---|---|
Mol Cancer Hsa_circ_0038737 promotes PARPi resistance in castration-resistant prostate cancer via IGF2BP3-mediated DNPH1 mRNA stabilization. | ||
Biosens Bioelectron PAM-assembled CRISPR-Cas12a activation-based fluorescent and colorimetric dual-modal biosensor for detecting prostate cancer exosomes. | ||
J Med Chem A Novel Type of PSMA-Targeting Ligands via β-Branched Aromatic α-Amino Acid Modification, Bearing Enhanced Tumor Targeting and Reduced Renal Toxicity. | ||
Sci Rep Cancer cell's neuroendocrine feature can be acquired through cell-cell fusion during cancer-neural stem cell interaction. | ||
RSC Med Chem Design, synthesis and biological evaluation of a novel PSMA-PI3K small molecule drug conjugate | ||
Am J Clin Exp Urol Transmembrane prostatic acid phosphatase: a therapeutic target in advanced prostate cancer |
