• Featured Product
  • KD/KO Validated

Cytokeratin 13 Monoclonal antibody, PBS Only (Capture)

Cytokeratin 13 Monoclonal Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA
Cat No. 66684-1-PBS
Clone No.1E10G2

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

KRT13, 1E10G2, CK 13, CK13, CK-13

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66684-1-PBS targets Cytokeratin 13 as part of a matched antibody pair:

MP51141-1: 66684-1-PBS capture and 66684-2-PBS detection (validated in Cytometric bead array)

MP51141-3: 66684-1-PBS capture and 66684-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0217

Product name: Recombinant human KRT13 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 183-458 aa of BC002661

Sequence: ARLAVDDFRLKYENELALRQSVEADINGLRRVLDELTLSKTDLEMQIESLNEELAYMKKNHEEEMKEFSNQVVGQVNVEMDATPGIDLTRVLAEMREQYEAMAERNRRDAEEWFHAKSAELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETECRYALQLQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP

Predict reactive species
Full Name keratin 13
Calculated Molecular Weight 50 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC002661
Gene Symbol Cytokeratin 13
Gene ID (NCBI) 3860
RRIDAB_2882038
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP13646
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia. The Keratin 13 (KRT13) gene encodes a type I acidic keratin which is expressed in the differentiated cells of non-cornified stratified squamous epithelia. This antibody can react with Cytokeratin 15.

Loading...
||
New chat

Able

正在加载,请稍候...