Use Able AI chat for product recommendations

Factor VIII Monoclonal antibody

Factor VIII Monoclonal Antibody for WB, ELISA

Cat No. 66722-1-Ig
Clone No. 1C11E11
Publications (2)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, ELISA

F8, 1C11E11, AHF, Antihemophilic factor, Coagulation factor VIII

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Factor VIII in ?

Tested Applications

Positive WB detected inhuman plasma tissue, human blood tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66722-1-Ig targets Factor VIII in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivitypig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag15772

Product name: Recombinant human F8 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 2144-2351 aa of BC022513

Sequence: VFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY

Predict reactive species
Full Name coagulation factor VIII, procoagulant component
Calculated Molecular Weight 2351 aa, 267 kDa
Observed Molecular Weight 70 kDa
GenBank Accession NumberBC022513
Gene Symbol F8
Gene ID (NCBI) 2157
RRIDAB_2882073
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP00451
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

F8, also named as FVIII, AHF, and F8C, belongs to the multicopper oxidase family. F8, along with calcium and phospholipid, acts as a cofactor for factor IXa when it converts factor X to the activated form, factor Xa. FVIII is translated into a single-chain polypeptide (SCh) with the A1-A2-B-A3-C1-C2 domain, which can undergo glycosylation, sulfonation, and variable cleavage. The FVIII molecule is a heterodimer composed of a heavy chain (HCh, A1-A2-B domain, 90-210 kDa) and a light chain (LCh, A3-C1-C2 domain, 70-80 kDa)(PMID: 28109042; 18650448; 29292164). This antibody can recognize the light chain.

Protocols

Product Specific Protocols
WB protocol for Factor VIII antibody 66722-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Factor VIII Monoclonal antibody (1C11E11), catalog number 66722-1-Ig, has a total of 2 citations. These appear in Veterinary Research (Vet Res) and Journal of Thoracic Disease (J Thorac Dis). The cited research spans coagulation biology (TRIM28 regulation of the coagulation cascade in African swine fever virus) and respiratory pathology (circRNA expression in pulmonary microvascular endothelial cells during acute respiratory distress syndrome).

SpeciesApplicationTitle
pigWB

Vet Res

TRIM28 regulates the coagulation cascade inhibited by p72 of African swine fever virus

Authors - Xuejiao Zhu
  • KD Validated

J Thorac Dis

Transcriptome sequencing showed the differential expression of circRNAs in human pulmonary microvascular endothelial cells in acute respiratory distress syndrome

Authors - Nan Wang
Loading...
||
New chat

Able™

正在加载,请稍候...