Factor VIII Monoclonal antibody, PBS Only

• 

  WB analysis of human plasma using 66722-1-Ig (same clone as 66722-1-PBS)

  human plasma were subjected to SDS PAGE followed by western blot with 66722-1-Ig (F8 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66722-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human blood using 66722-1-Ig (same clone as 66722-1-PBS)

  human blood were subjected to SDS PAGE followed by western blot with 66722-1-Ig (F8 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66722-1-PBS in a different storage buffer formulation.

Factor VIII Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66722-1-PBS

Clone No.1C11E11

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

F8, 1C11E11, AHF, Antihemophilic factor, Coagulation factor VIII

---

Product Information

66722-1-PBS targets Factor VIII in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15772

  Product name: Recombinant human F8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 2144-2351 aa of BC022513

  Sequence: VFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY

• Full Name: coagulation factor VIII, procoagulant component
• Calculated Molecular Weight: 2351 aa, 267 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC022513
• Gene Symbol: F8
• Gene ID (NCBI): 2157
• RRID: AB_2882073
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P00451
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

F8, also named as FVIII, AHF, and F8C, belongs to the multicopper oxidase family. F8, along with calcium and phospholipid, acts as a cofactor for factor IXa when it converts factor X to the activated form, factor Xa. FVIII is translated into a single-chain polypeptide (SCh) with the A1-A2-B-A3-C1-C2 domain, which can undergo glycosylation, sulfonation, and variable cleavage. The FVIII molecule is a heterodimer composed of a heavy chain (HCh, A1-A2-B domain, 90-210 kDa) and a light chain (LCh, A3-C1-C2 domain, 70-80 kDa)(PMID: 28109042; 18650448; 29292164). This antibody can recognize the light chain.