Tested Applications
| Positive WB detected in | HEK-293 cells, HepG2 cells, Jurkat cells |
| Positive IHC detected in | human pancreas cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66725-1-Ig targets Thymidylate synthase in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7027 Product name: Recombinant human TYMS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-313 aa of BC002567 Sequence: MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV Predict reactive species |
| Full Name | thymidylate synthetase |
| Calculated Molecular Weight | 36 kDa |
| Observed Molecular Weight | 36 kDa |
| GenBank Accession Number | BC002567 |
| Gene Symbol | TYMS |
| Gene ID (NCBI) | 7298 |
| RRID | AB_2882076 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P04818 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Thymidylate synthase gene (TYMS) encodes thymidylate synthase (TS) which is an important factor in the growth of tumor cells. TS can catalyze the transformation of intracellular uridine monophosphate (dump) into dTMP which is required for DNA replication and repairing. TS is a key enzyme in the process of cell proliferation, also is the important target enzymes of 5-FU and other chemotherapy drugs. The expression of TYMS is negatively correlated with the efficacy of chemotherapy and the prognosis of patients who suffer from rectal cancer, breast cancer, colorectal cancer, gastric cancer, head and neck cancer, esophageal cancer, pancreatic cancer and so on.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Thymidylate synthase antibody 66725-1-Ig | Download protocol |
| IF protocol for Thymidylate synthase antibody 66725-1-Ig | Download protocol |
| IHC protocol for Thymidylate synthase antibody 66725-1-Ig | Download protocol |
| WB protocol for Thymidylate synthase antibody 66725-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Thymidylate synthase Monoclonal antibody (1F5B7), catalog number 66725-1-Ig, has 4 total citations. These appear in Cell Death & Disease, Journal of Medicinal Chemistry, Frontiers in Immunology, and Biochemical Pharmacology. The associated research fields span cancer biology—including HER2-negative breast cancer and esophageal squamous cell carcinoma—as well as medicinal chemistry and anti-cancer drug design, with applications in Western blot and immunofluorescence.
| Species | Application | Title |
|---|---|---|
Cell Death Dis Everolimus destabilizes thymidylate synthase via suppressing its O-GlcNAcylation and sensitizes HER2-negative breast cancer to fluorouracil. | ||
Front Immunol Single-cell sequencing analysis reveals cancer-associated pericyte subgroup in esophageal squamous cell carcinoma to predict prognosis | ||
Biochem Pharmacol Design, synthesis and biological evaluation of novel curcumin-fluorouracil hybrids as potential anti-cancer agents |
Reviews
What customers say
Reviews for this antibody are mixed. One user rated it 5 stars, noting it works well for Western Blot at a 1:8000 dilution on HepG2 and mouse liver, but emphasized it only recognizes the human origin of the target. Another user gave it 1 star, reporting it did not work at a 1:1000 dilution on mouse liver, mouse brain, or HepG2. Overall, results appear highly dependent on species specificity and dilution, with successful use limited to human samples.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Hua (Verified Customer) (07-08-2026) | Good antibody for WB. Only recognizes human origin of TS.
 |
Hua (Verified Customer) (03-26-2021) | Not working
 |
