Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Thymidylate synthase Monoclonal antibody

Thymidylate synthase Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 66725-1-Ig
Clone No.1F5B7

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

TYMS, 1F5B7, DKCD, EC:2.1.1.45, HsT422

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HepG2 cells, Jurkat cells
Positive IHC detected inhuman pancreas cancer tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66725-1-Ig targets Thymidylate synthase in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7027

Product name: Recombinant human TYMS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-313 aa of BC002567

Sequence: MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV

Predict reactive species
Full Name thymidylate synthetase
Calculated Molecular Weight 36 kDa
Observed Molecular Weight 36 kDa
GenBank Accession NumberBC002567
Gene Symbol TYMS
Gene ID (NCBI) 7298
RRIDAB_2882076
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04818
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Thymidylate synthase gene (TYMS) encodes thymidylate synthase (TS) which is an important factor in the growth of tumor cells. TS can catalyze the transformation of intracellular uridine monophosphate (dump) into dTMP which is required for DNA replication and repairing. TS is a key enzyme in the process of cell proliferation, also is the important target enzymes of 5-FU and other chemotherapy drugs. The expression of TYMS is negatively correlated with the efficacy of chemotherapy and the prognosis of patients who suffer from rectal cancer, breast cancer, colorectal cancer, gastric cancer, head and neck cancer, esophageal cancer, pancreatic cancer and so on.

Protocols

Product Specific Protocols
FC protocol for Thymidylate synthase antibody 66725-1-IgDownload protocol
IF protocol for Thymidylate synthase antibody 66725-1-IgDownload protocol
IHC protocol for Thymidylate synthase antibody 66725-1-IgDownload protocol
WB protocol for Thymidylate synthase antibody 66725-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

J Med Chem

Fuplatin: An Efficient and Low-Toxic Dual-Prodrug

Authors - Ran Zhang
humanIF

Front Immunol

Single-cell sequencing analysis reveals cancer-associated pericyte subgroup in esophageal squamous cell carcinoma to predict prognosis

Authors - Kai Xiong
humanWB

Cell Death Dis

Everolimus destabilizes thymidylate synthase via suppressing its O-GlcNAcylation and sensitizes HER2-negative breast cancer to fluorouracil.

Authors - Xiao-Ting Jiang
humanWB

Biochem Pharmacol

Design, synthesis and biological evaluation of novel curcumin-fluorouracil hybrids as potential anti-cancer agents

Authors - Xiaotong Wang

Reviews

    3.0 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Hua (Verified Customer) (07-08-2026)

Good antibody for WB. Only recognizes human origin of TS.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:8000
  • Cell Tissue Type: HepG2, mouse liver
Thymidylate synthase Antibody Western Blot validation (1:8000 dilution) in HepG2, mouse liver (Cat no:66725-1-Ig)

Hua (Verified Customer) (03-26-2021)

Not working

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse liver, mouse brain / HepG2
Thymidylate synthase Antibody Western Blot validation (1:1000 dilution) in Mouse liver, mouse brain / HepG2 (Cat no:66725-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...