• Featured Product
  • KD/KO Validated

SOX10 Monoclonal antibody

SOX10 Monoclonal Antibody for WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA

Cat No. 66786-1-Ig
Clone No.1D2C8

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA

1D2C8, DOM, PCWH, SRY-box transcription factor 9, Transcription factor SOX 10

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA375 cells, MDA-MB-453 cells
Positive IHC detected inhuman malignant melanoma tissue, mouse brain tissue, rat cerebellum tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat brain tissue, mouse brain tissue
Positive IF-Fro detected inmouse brain tissue
Positive FC (Intra) detected inC6 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:300-1:1200
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)-FROIF-FRO : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66786-1-Ig targets SOX10 in WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, rabbit, chicken
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag23191

Product name: Recombinant human SOX10 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 267-466 aa of BC002824

Sequence: GKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP

Predict reactive species
Full Name SRY (sex determining region Y)-box 10
Calculated Molecular Weight 50 kDa
Observed Molecular Weight 55-60 kDa
GenBank Accession NumberBC002824
Gene Symbol SOX10
Gene ID (NCBI) 6663
RRIDAB_2882131
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP56693
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sox10 is a transcription factor that has a crucial role in complex signalling pathways regulating central nervous system and neural crest development. The calcualted molecular weight of SOX10 is 50 kDa, but modified SOX10 is about 55-60 kDa. (PMID: 23799842)

Protocols

Product Specific Protocols
WB protocol for SOX10 antibody 66786-1-IgDownload protocol
IHC protocol for SOX10 antibody 66786-1-IgDownload protocol
IF protocol for SOX10 antibody 66786-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Elife

Myelinating Schwann cells and Netrin-1 control intra-nervous vascularization of the developing mouse sciatic nerve.

Authors - Sonia Taïb
chickenIF

Front Physiol

Cadherin-11 Is Required for Neural Crest Specification and Survival.

Authors - Subrajaa Manohar
ratIF

Physiol Behav

Non-neuronal crosstalk promotes an inflammatory response in nodose ganglia cultures after exposure to byproducts from gram positive, high-fat-diet-associated gut bacteria.

Authors - Carolina R Cawthon
IF

J Neurosci Methods

Characterization of the GfaABC1D promoter to selectively target astrocytes in the rhesus macaque brain.

Authors - Kate S Heffernan
rabbitWB

Anim Biosci

Exosomal miR-222-3p derived from dermal papilla cells inhibits melanogenesis in melanocytes by targeting SOX10 in rabbits

Authors - Yang Chen
rabbitIHC

Res Sq

Pleiotrophin-Neuregulin1 promote axon regeneration and sorting in conduit repair of critical nerve gap injuries

Authors - Mario RomeroOrtega

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Sonia (Verified Customer) (07-24-2019)

Works fine in longitudinal section of mouse sciatic nerve

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1/200
  • Cell Tissue Type: sciatic nerve
SOX10 Antibody Immunofluorescence, validation (1/200 dilution) in sciatic nerve (Cat no:66786-1-Ig)
FH

Crystal (Verified Customer) (02-19-2019)

Works great in chicken embryos! We used 1:500-1:1000 dilution for the primary and made sure to wash it extensively between primary and secondary.

  • Applications: Immunohistochemistry,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Chicken Embryo
Loading...
||
New chat Able
正在加载,请稍候...