SOX10 Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis of A375 using 66786-1-Ig (same clone as 66786-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 66786-1-Ig (SOX10 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66786-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MDA-MB-453 using 66786-1-Ig (same clone as 66786-1-PBS)

  WB result of SOX10 antibody (66786-1-Ig; 1:5000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SOX10 transfected MDA-MB-453 cells. This data was developed using the same antibody clone with 66786-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human malignant melanoma using 66786-1-Ig (same clone as 66786-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 66786-1-Ig (SOX10 antibody) at dilution of 1:300 (under 40x lens). This data was developed using the same antibody clone with 66786-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat cerebellum using 66786-1-Ig (same clone as 66786-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 66786-1-Ig (SOX10 antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66786-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human malignant melanoma using 66786-1-Ig (same clone as 66786-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 66786-1-Ig (SOX10 antibody) at dilution of 1:300 (under 10x lens). This data was developed using the same antibody clone with 66786-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66786-1-Ig (same clone as 66786-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66786-1-Ig (SOX10 antibody) at dilution of 1:800 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66786-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66786-1-Ig (same clone as 66786-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66786-1-Ig (SOX10 antibody) at dilution of 1:800 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66786-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 66786-1-Ig (same clone as 66786-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using SOX10 antibody (66786-1-Ig, Clone: 1D2C8 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66786-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat brain using 66786-1-Ig (same clone as 66786-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using SOX10 antibody (66786-1-Ig, Clone: 1D2C8 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66786-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 66786-1-Ig (same clone as 66786-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse brain tissue using SOX10 antibody (66786-1-Ig, Clone: 1D2C8 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66786-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A375 using 66786-1-Ig (same clone as 66786-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A375 cells using SOX10 antibody (66786-1-Ig, Clone: 1D2C8 ) at dilution of 1:2000 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ). This data was developed using the same antibody clone with 66786-1-PBS in a different storage buffer formulation.

• 

  FC experiment of C6 using 66786-1-Ig (same clone as 66786-1-PBS)

  1X10^6 C6 cells were intracellularly stained with 0.4 ug Anti-Human SOX10 (66786-1-Ig, Clone:1D2C8) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2a Isotype Control (66360-2-Ig, Clone: K11A1B2A2) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 66786-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP50275-1

  Cytometric bead array standard curve of MP50275-1, SOX10 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66786-1-PBS. Detection antibody: 66786-2-PBS. Standard:Ag23191. Range: 1.563-100 ng/mL.

• Featured Product
• KD/KO Validated

SOX10 Monoclonal Antibody for WB, IHC, IF-P, IF-Fro, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 66786-1-PBS

Clone No.1D2C8

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IF-Fro, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

1D2C8, DOM, PCWH, SRY-box transcription factor 9, Transcription factor SOX 10

---

Product Information

66786-1-PBS targets SOX10 as part of a matched antibody pair:

MP50275-1: 66786-1-PBS capture and 66786-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23191

  Product name: Recombinant human SOX10 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 267-466 aa of BC002824

  Sequence: GKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP

• Full Name: SRY (sex determining region Y)-box 10
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC002824
• Gene Symbol: SOX10
• Gene ID (NCBI): 6663
• RRID: AB_2882131
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P56693
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Sox10 is a transcription factor that has a crucial role in complex signalling pathways regulating central nervous system and neural crest development. The calcualted molecular weight of SOX10 is 50 kDa, but modified SOX10 is about 55-60 kDa. (PMID: 23799842)