Tested Applications
| Positive WB detected in | pig brain tissue, A431 cells, A549 cells, HeLa cells, HEK-293 cells, NIH/3T3 cells, rabbit brain tissue, rat brain tissue, mouse brain tissue |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:20000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:2000-1:8000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66881-1-Ig targets Flotillin 2 in WB, IHC, IF/ICC, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28308 Product name: Recombinant human Flotillin 2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-379 aa of BC017292 Sequence: MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV Predict reactive species |
| Full Name | flotillin 2 |
| Calculated Molecular Weight | 379 aa, 42 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | BC017292 |
| Gene Symbol | Flotillin 2 |
| Gene ID (NCBI) | 2319 |
| RRID | AB_2882213 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q14254 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Flotillins are membrane-associated proteins that contain two homologous isoforms, flotillin 1 (FLOT1) and flotillin 2 (FLOT2). They are highly conserved and widely expressed proteins that commonly used as markers of lipid rafts. Flotillins are involved in various signaling pathways, cell adhesion, membrane trafficking and axonal growth.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Flotillin 2 antibody 66881-1-Ig | Download protocol |
| IF protocol for Flotillin 2 antibody 66881-1-Ig | Download protocol |
| IHC protocol for Flotillin 2 antibody 66881-1-Ig | Download protocol |
| WB protocol for Flotillin 2 antibody 66881-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-FLOT2 (Flotillin-2) antibody (Cat# 66881-1-Ig) has 9 citations published in journals including Cell Metabolism, Nature Cell Biology, Nature Communications, Journal of Extracellular Vesicles, International Journal of Oncology, Pharmaceutics, Journal of Dermatological Science, Toxins, and Hepatology Research. Research fields span cancer biology (gastric, pancreatic, breast, glioma, cholangiocarcinoma, squamous cell carcinoma), extracellular vesicle/exosome biology, RNA regulation, bone injury repair, and toxin–membrane interactions.
| Species | Application | Title |
|---|---|---|
Cell Metab Nicotinamide metabolism face-off between macrophages and fibroblasts manipulates the microenvironment in gastric cancer | ||
Nat Cell Biol Psychological stress-induced ALKBH5 deficiency promotes tumour innervation and pancreatic cancer via extracellular vesicle transfer of RNA | ||
J Extracell Vesicles Baohuoside I chemosensitises breast cancer to paclitaxel by suppressing extracellular vesicle/CXCL1 signal released from apoptotic cells | ||
Nat Commun Cross-linking of the endolysosomal system reveals potential flotillin structures and cargo | ||
Int J Oncol Neural stem cell‑derived exosomes transfer miR‑124‑3p into cells to inhibit glioma growth by targeting FLOT2 | ||
Pharmaceutics Exosomes Derived from BMSCs Treated with CeONPs Ameliorate Radiation-Induced Jaw Bone Injury via miR-21-5p/STAT3 Axis-Mediated Osteogenesis and ROS Scavenging. |
Reviews
What customers say
One reviewer used this antibody for Western Blot at a 1:2500 dilution on ARPE-19 cells. They rated it 2 out of 5, noting that the band they identified as the target was uncertain, suggesting the result was not fully conclusive. Overall, the single review reflects a mixed experience with the antibody's performance in detecting the intended target under the tested conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Guorong (Verified Customer) (03-22-2022) | The band marked by the red dot may be the target
 |
