RACK1; GNB2L1 Monoclonal antibody

RACK1; GNB2L1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 66940-1-Ig
Clone No.1E11A7

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat, Pig and More (4)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Gnb2 rs1, GNB2L1, H12.3, HLC 7, PIG21, RACK1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, pig liver tissue, NIH/3T3 cells, HSC-T6 cells, HepG2 cells, T-47D cells, L02 cells
Positive IHC detected inhuman lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66940-1-Ig targets RACK1; GNB2L1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig samples.

Tested Reactivity Human, Mouse, Rat, Pig
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26708

Product name: Recombinant human RACK1; GNB2L1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 131-317 aa of BC019093

Sequence: LWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQVTIGTR

Predict reactive species
Full Name guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1
Calculated Molecular Weight 36 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC019093
Gene Symbol RACK1
Gene ID (NCBI) 10399
RRIDAB_2882264
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP63244
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Members of the protein kinase C (PKC) family play a key regulatory role in a variety of cellular functions, including cell growth and differentiation, gene expression, hormone secretion and membrane function. RACK1 (receptor for activated protein kinase C 1), encoded by GNB2L1 gene, is a 317 amino acid guanine nucleotide-binding protein subunit beta-2-like 1 protein which is involved in the recruitment, assembly and/or regulation of a variety of signaling molecules, it contains 7 WD-repeats and is implicated in various protein interaction activities. RACK1 is a component of the 40S ribosomal subunit involved in translational repression. Recent finding suggests that RACK1 may be a new promising diagnosis biomarker and therapeutic target for non-small-cell lung cancer (NSCLC).

Protocols

Product Specific Protocols
IF protocol for RACK1; GNB2L1 antibody 66940-1-IgDownload protocol
IHC protocol for RACK1; GNB2L1 antibody 66940-1-IgDownload protocol
WB protocol for RACK1; GNB2L1 antibody 66940-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

J Clin Invest

CAP2 promotes gastric cancer metastasis by mediating the interaction between tumor cells and tumor-associated macrophages

Authors - Guohao Zhang

PNAS Nexus

Ribosome stalling during c-myc translation presents actionable cancer cell vulnerability

Authors - Tejinder Pal Khaket
pigWB

J Virol

VP3 protein of Senecavirus A promotes viral IRES-driven translation and attenuates innate immunity by specifically relocalizing hnRNPA2B1

Authors - Lu Li
mouse,ratIP,WB

Am J Physiol Renal Physiol

Neuropilin 1 Promotes Unilateral Ureteral Obstruction-Induced Renal Fibrosis via RACK1 in Renal Tubular Epithelial Cells

Authors - Ling Hou
humanWB

Inflamm Res

The protective role of RACK1 in hepatic ischemia‒reperfusion injury-induced ferroptosis

Authors - Zelong Yang
humanWB

J Med Chem

Azoacetylene Electrophiles for Proteome-wide Ligand and Target Discovery: Supporting Targeted Protein Degradation

Authors - Jiayi Du
Loading...
||
New chat Able
正在加载,请稍候...