Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

TMEM119 Monoclonal antibody

TMEM119 Monoclonal Antibody for WB, ELISA

Cat No. 66948-1-Ig
Clone No.1E7A2

Host / Isotype

Mouse / IgG3

Reactivity

Human, Pig, Mouse, Rat, rabbit and More (4)

Applications

WB, ELISA

TMEM119, transmembrane protein 119, UNQ731/PRO1415

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrabbit brain tissue, rat brain tissue, mouse brain tissue, pig cerebellum tissue, pig brain tissue, rat cerebellum tissue, mouse cerebellum tissue, Rabbit cerebellum tissue, Chicken brain tissue

This antibody is not recommended for IHC/IF test.

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66948-1-Ig targets TMEM119 in WB, ELISA applications and shows reactivity with Human, Pig, Mouse, Rat, rabbit samples.

Tested Reactivity Human, Pig, Mouse, Rat, rabbit
Cited Reactivityhuman, mouse, rat, canine
Host / Isotype Mouse / IgG3
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26286

Product name: Recombinant human TMEM119 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 119-218 aa of NM_181724

Sequence: MRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQE

Predict reactive species
Full Name transmembrane protein 119
Calculated Molecular Weight 29 kDa
Observed Molecular Weight 52 kDa
GenBank Accession NumberNM_181724
Gene Symbol TMEM119
Gene ID (NCBI) 338773
RRIDAB_2882272
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ4V9L6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMEM119 immunohistochemistry might provide a useful tool for investigating the biology and pathology of human microglia(PMID: 26250788). Microglia can be detected clearly using Catalog#66948-1-Ig. The predicted MW of TMEM119 is 29 kDa. Catalog#66948-1-Ig recognizes 50 kDa band may due to glycosylation.

Protocols

Product Specific Protocols
WB protocol for TMEM119 antibody 66948-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouse

ACS Nano

Neutrophil Nanovesicle Protects against Experimental Autoimmune Encephalomyelitis through Enhancing Myelin Clearance by Microglia

Authors - Shishi Shen
mouseWB

J Extracell Vesicles

Characterization of brain-derived extracellular vesicles reveals changes in cellular origin after stroke and enrichment of the prion protein with a potential role in cellular uptake.

Authors - Santra Brenna
mouseWB

Int J Biol Sci

Defective neurite elongation and branching in Nibp/Trappc9 deficient zebrafish and mice

Authors - Min Hu
mouseWB

Acta Pharmacol Sin

Prebiotic diet normalizes aberrant immune and behavioral phenotypes in a mouse model of autism spectrum disorder

Authors - Naika Prince
rat

Oxid Med Cell Longev

Methane-Rich Saline Alleviates CA/CPR Brain Injury by Inhibiting Oxidative Stress, Microglial Activation-Induced Inflammatory Responses, and ER Stress-Mediated Apoptosis.

Authors - Ruixia Cui
human

Antioxidants (Basel)

TNF-α Levels Are Increased in Patients with Subjective Cognitive Impairment and Are Negatively Correlated with β Amyloid-42

Authors - Sara Serafini

Reviews

    2.0 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Amirah (Verified Customer) (03-02-2023)

The antibody works using the antigen retrieval method beforehand and using normal goat serum as a blocking buffer. Images not perfect but it still allows the antibody to be expressed.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Rat Brain Tissue-Fixed

Hannes (Verified Customer) (03-08-2021)

The antibody did not work in IHC-p on human and murine brain tissue.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:250 - 1:1000 tested
  • Cell Tissue Type: Brain
TMEM119 Antibody Immunohistochemistry validation (1:250 - 1:1000 tested dilution) in Brain (Cat no:66948-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...