Use Able AI chat for product recommendations

CDK4 Monoclonal antibody

CDK4 Monoclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 66950-1-Ig
Clone No.1G2C12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, FC (Intra), ELISA

PSK J3, EC:2.7.11.22, Cyclin-dependent kinase 4, cyclin dependent kinase 4, CMM3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, HeLa cells, HEK-293 cells, 4T1 cells, Jurkat cells, MCF-7 cells, HepG2 cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, RAW 264.7 cells
Positive IHC detected inhuman breast cancer tissue, human lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:200-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66950-1-Ig targets CDK4 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag20538

Product name: Recombinant human CDK4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-303 aa of BC010153

Sequence: MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

Predict reactive species
Full Name cyclin-dependent kinase 4
Calculated Molecular Weight 34 kDa
Observed Molecular Weight 34 kDa
GenBank Accession NumberBC010153
Gene Symbol CDK4
Gene ID (NCBI) 1019
RRIDAB_2882273
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP11802
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclin-dependent kinase-4 (CDK4) is a protein-serine kinase involved in the cell cycle. It is essential for the G1- to S-phase transition during the cell cycle and its expression is primarily controlled at the transcriptional level(PMID:17253961). CCND1-CDK4 axis is not only critical in glial tumor cells but also in stromal-derived cells in the surrounding tumor microenvironment that are vital to sustain tumor outgrowth(PMID:21844184).

Protocols

Product Specific Protocols
FC protocol for CDK4 antibody 66950-1-IgDownload protocol
IHC protocol for CDK4 antibody 66950-1-IgDownload protocol
WB protocol for CDK4 antibody 66950-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Phytomedicine

Transcriptomics and molecular docking reveal the potential mechanism of lycorine against pancreatic cancer

Authors - Xin Zhou
humanWB

J Med Chem

Design, Synthesis, and Biological Evaluation for First GPX4 and CDK Dual Inhibitors

Authors - Jiangmin Zhu
humanWB

Cell Oncol (Dordr)

LINC02154 promotes the proliferation and metastasis of hepatocellular carcinoma by enhancing SPC24 promoter activity and activating the PI3K-AKT signaling pathway.

Authors - Huan Yue
humanWB

Front Cell Dev Biol

NLGN3 Upregulates Expression of ADAM10 to Promote the Cleavage of NLGN3 via Activating the LYN Pathway in Human Gliomas.

Authors - Ning-Ning Dang
mouseWB

Front Cell Dev Biol

LHPP-Mediated Histidine Dephosphorylation Suppresses the Self-Renewal of Mouse Embryonic Stem Cells.

Authors - Rong Mu Xia
humanWB

Oxid Med Cell Longev

MICAL2 Contributes to Gastric Cancer Cell Proliferation by Promoting YAP Dephosphorylation and Nuclear Translocation

Authors - Chenxiang Qi
Loading...
||
New chat

Able

正在加载,请稍候...