Tested Applications
| Positive WB detected in | HUVEC cells, human placenta tissue |
| Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66952-1-Ig targets CD61 / Integrin beta 3 in WB, IHC, IP, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27834 Product name: Recombinant human ITGB3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 634-718 aa of BC127666 Sequence: CTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPD Predict reactive species |
| Full Name | integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61) |
| Calculated Molecular Weight | 788 aa, 87 kDa |
| Observed Molecular Weight | 100-110 kDa |
| GenBank Accession Number | BC127666 |
| Gene Symbol | Integrin beta 3 |
| Gene ID (NCBI) | 3690 |
| RRID | AB_2882275 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P05106 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Integrin beta-3, also named as CD61 and GPIIIa, is a receptor for cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin and von Willebrand factor. Integrin beta-3 recognize the sequence R-G-D in a wide array of ligands and the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen which leads to rapid platelet aggregation which physically plugs ruptured endothelial surface. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. Human integrin beta-3 has a calculated molecular weight of 87 kDa. As a result of glycosylation, the apparent molecular mass of integrin beta-3 is approximately 90-110 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CD61 / Integrin beta 3 antibody 66952-1-Ig | Download protocol |
| WB protocol for CD61 / Integrin beta 3 antibody 66952-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CD61 / Integrin beta 3 Monoclonal antibody (3D8E5) (Cat# 66952-1-Ig) has 8 citations published in journals including Adv Healthc Mater, Acta Pharmacol Sin, Drug Deliv, Reprod Biol Endocrinol, Sci Rep, BMC Biotechnol, Biomedicines, and Front Neurosci. Research fields span precision cancer therapy, platelet pharmacology, breast cancer metastasis, endometriosis pathogenesis, pulmonary fibrosis, targeted drug delivery, and ischemic stroke thrombus analysis.
| Species | Application | Title |
|---|---|---|
Adv Healthc Mater Nanobody-Conjugated Theranostic Prodrug Targeting α(v)β(3) Integrin Enables Precision Cancer Therapy With Real-Time Imaging. | ||
Acta Pharmacol Sin Adiponectin receptor agonist AdipoRon modulates human and mouse platelet function. | ||
Drug Deliv Suppression for lung metastasis by depletion of collagen I and lysyl oxidase via losartan assisted with paclitaxel-loaded pH-sensitive liposomes in breast cancer | ||
Reprod Biol Endocrinol Expression of Talin-1 in endometriosis and its possible role in pathogenesis. | ||
Sci Rep Periostin secreted by activated fibroblasts in idiopathic pulmonary fibrosis promotes tumorigenesis of non-small cell lung cancer.
| ||
BMC Biotechnol αvβ3-targeted sEVs for efficient intracellular delivery of proteins using MFG-E8. |
