Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CD61 / Integrin beta 3 Monoclonal antibody

CD61 / Integrin beta 3 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66952-1-Ig
Clone No. 3D8E5
Publications (8)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

Human and More (2)

Applications

WB, IHC, IP, ELISA

CD61, GP3A, GPIIIa, Integrin beta 3, ITGB3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CD61 / Integrin beta 3 in ?

Tested Applications

Positive WB detected inHUVEC cells, human placenta tissue
Positive IHC detected inhuman placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66952-1-Ig targets CD61 / Integrin beta 3 in WB, IHC, IP, ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27834

Product name: Recombinant human ITGB3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 634-718 aa of BC127666

Sequence: CTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPD

Predict reactive species
Full Name integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61)
Calculated Molecular Weight 788 aa, 87 kDa
Observed Molecular Weight 100-110 kDa
GenBank Accession NumberBC127666
Gene Symbol Integrin beta 3
Gene ID (NCBI) 3690
RRIDAB_2882275
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP05106
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Integrin beta-3, also named as CD61 and GPIIIa, is a receptor for cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin and von Willebrand factor. Integrin beta-3 recognize the sequence R-G-D in a wide array of ligands and the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen which leads to rapid platelet aggregation which physically plugs ruptured endothelial surface. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. Human integrin beta-3 has a calculated molecular weight of 87 kDa. As a result of glycosylation, the apparent molecular mass of integrin beta-3 is approximately 90-110 kDa.

Protocols

Product Specific Protocols
IHC protocol for CD61 / Integrin beta 3 antibody 66952-1-IgDownload protocol
WB protocol for CD61 / Integrin beta 3 antibody 66952-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The CD61 / Integrin beta 3 Monoclonal antibody (3D8E5) (Cat# 66952-1-Ig) has 8 citations published in journals including Adv Healthc Mater, Acta Pharmacol Sin, Drug Deliv, Reprod Biol Endocrinol, Sci Rep, BMC Biotechnol, Biomedicines, and Front Neurosci. Research fields span precision cancer therapy, platelet pharmacology, breast cancer metastasis, endometriosis pathogenesis, pulmonary fibrosis, targeted drug delivery, and ischemic stroke thrombus analysis.

SpeciesApplicationTitle
humanWB

Adv Healthc Mater

Nanobody-Conjugated Theranostic Prodrug Targeting α(v)β(3) Integrin Enables Precision Cancer Therapy With Real-Time Imaging.

Authors - Sanu Karan
humanWB

Acta Pharmacol Sin

Adiponectin receptor agonist AdipoRon modulates human and mouse platelet function.

Authors - Xiang-Hui Zhou
mouseWB

Drug Deliv

Suppression for lung metastasis by depletion of collagen I and lysyl oxidase via losartan assisted with paclitaxel-loaded pH-sensitive liposomes in breast cancer

Authors - Li Zhang
humanWB

Reprod Biol Endocrinol

Expression of Talin-1 in endometriosis and its possible role in pathogenesis.

Authors - Xian Tang
human,mouseWB,IHC

Sci Rep

Periostin secreted by activated fibroblasts in idiopathic pulmonary fibrosis promotes tumorigenesis of non-small cell lung cancer.

Authors - Hiroyuki Yamato
  • KD Validated
humanWB,IP

BMC Biotechnol

αvβ3-targeted sEVs for efficient intracellular delivery of proteins using MFG-E8.

Authors - Junxin Mai
Loading...
||
New chat

Able™

正在加载,请稍候...