CRK Monoclonal antibody, PBS Only (Capture)

CRK Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 67035-1-PBS
Clone No.2B7E1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

2B7E1, Adapter molecule crk, CRKII, p38, Proto oncogene c Crk

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67035-1-PBS targets CRK as part of a matched antibody pair:

MP51643-1: 67035-1-PBS capture and 67035-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28793

Product name: Recombinant human CRK protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 41-304 aa of BC008506

Sequence: STSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPDEDFS

Predict reactive species
Full Name v-crk sarcoma virus CT10 oncogene homolog (avian)
Calculated Molecular Weight 34 kDa
Observed Molecular Weight 34 kDa
GenBank Accession NumberBC008506
Gene Symbol CRK
Gene ID (NCBI) 1398
RRIDAB_2882350
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP46108
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CRK is a member of an adapter protein family that binds to several tyrosine-phosphorylated proteins. CRK has several SH2 and SH3 domains (src-homology domains) and is involved in several signaling pathways, recruiting cytoplasmic proteins in the vicinity of tyrosine kinase through SH2-phosphotyrosine interaction. The N-terminal SH2 domain of this protein functions as a positive regulator of transformation whereas the C-terminal SH3 domain functions as a negative regulator of transformation.

Loading...
||
New chat

Able

正在加载,请稍候...