Tested Applications
| Positive WB detected in | rat brain tissue, rat cerebellum tissue, mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67083-1-Ig targets EAAT2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19816 Product name: Recombinant human SLC1A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 460-574 aa of BC132768 Sequence: PTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK Predict reactive species |
| Full Name | solute carrier family 1 (glial high affinity glutamate transporter), member 2 |
| Calculated Molecular Weight | 574 aa, 62 kDa |
| Observed Molecular Weight | 60-70 kDa |
| GenBank Accession Number | BC132768 |
| Gene Symbol | EAAT2 |
| Gene ID (NCBI) | 6506 |
| RRID | AB_2882391 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P43004 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
EAAT2 (also known as GLT-1), is encoded by SLC1A2 and is a glutamate transporter which can clear the majority of extracellular glutamate in brain and prevent brain seizures.Three isoforms of EAAT2 exist due to the alternative splicing. In addition to the 65-70 kDa monomer form, 130-150 kDa dimer of EAAT2 can also be observed on SDS-PAGE.(PMID: 22114258)
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for EAAT2 antibody 67083-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The EAAT2 Monoclonal antibody (1C8D10), catalog number 67083-1-Ig, has 3 citations. These appear in Neuron, Cell Reports in Medicine, and Frontiers in Neuroscience. The research fields span spinal cord astrocyte biology and neuropathic pain, amyotrophic lateral sclerosis (ALS) motor neuron protection, and astrocytic glycolysis in Alzheimer's disease.
| Species | Application | Title |
|---|---|---|
Neuron GPR37L1 identifies spinal cord astrocytes and protects neuropathic pain after nerve injury | ||
Cell Rep Med TwinF interface inhibitor FP802 stops loss of motor neurons and mitigates disease progression in a mouse model of ALS | ||
Front Neurosci ALDOC modulates astrocytic glycolysis and AMPK/mTOR/HIF-1α signaling in Alzheimer's disease. |
