TROVE2 Monoclonal antibody

TROVE2 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67149-1-Ig

Clone No. 2A4E5

Publications (1)

Review Product

Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat and More (1)

Applications

WB, IHC, ELISA

Synonyms

60 kDa ribonucleoprotein Ro, 60 kDa Ro protein, Ro 60 kDa autoantigen, RO60, RoRNP, Sjoegren syndrome antigen A2, SS A, SSA2, TROVE domain family member 2, TROVE domain family, member 2, TROVE2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis of HeLa using 67149-1-Ig
HeLa cells were subjected to SDS PAGE followed by western blot with 67149-1-Ig (TROVE2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HEK-293 using 67149-1-Ig
HEK-293 cells were subjected to SDS PAGE followed by western blot with 67149-1-Ig (TROVE2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of MCF-7 using 67149-1-Ig
MCF-7 cells were subjected to SDS PAGE followed by western blot with 67149-1-Ig (TROVE2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Jurkat using 67149-1-Ig
Jurkat cells were subjected to SDS PAGE followed by western blot with 67149-1-Ig (TROVE2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 67149-1-Ig
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67149-1-Ig (TROVE2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 67149-1-Ig
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67149-1-Ig (TROVE2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 67149-1-Ig
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67149-1-Ig (TROVE2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 67149-1-Ig
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67149-1-Ig (TROVE2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TROVE2 in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HeLa cells, MCF-7 cells, Jurkat cells, HEK-293 cells
Positive IHC detected in	mouse brain tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
Immunohistochemistry (IHC)	IHC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67149-1-Ig targets TROVE2 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity	Human, Mouse, Rat
Cited Reactivity	human
Host / Isotype	Mouse / IgG2a
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag4379 Product name: Recombinant human TROVE2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 21-369 aa of BC036658 Sequence: DGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGK Predict reactive species
Full Name	TROVE domain family, member 2
Calculated Molecular Weight	60 kDa
Observed Molecular Weight	60 kDa
GenBank Accession Number	BC036658
Gene Symbol	TROVE2
Gene ID (NCBI)	6738
RRID	AB_2882447
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P10155
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TROVE2, also named as RO60 or RoRNP, is a 538 amino acid protein, which is localized in cytoplasmic mRNP granules containing untranslated mRNAs. TROVE2 as a RNA-binding protein that binds to misfolded non-coding RNAs, pre-5S rRNA, and several small cytoplasmic RNA molecules known as Y RNAs. TROVE2 may stabilize some of these RNAs and protect them from degradation (PubMed:18056422). TROVE2 binds to endogenous Alu retroelements which are induced by type I IFN and stimulate porinflammaotry cytokine secretion.

Protocols

Product Specific Protocols
IHC protocol for TROVE2 antibody 67149-1-Ig	Download protocol
WB protocol for TROVE2 antibody 67149-1-Ig	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

TROVE2 Monoclonal antibody (67149-1-Ig)

The antibody has a total of 1 citation. It appears in one publication: Cell (2026), "Mechanistic insights into RNA chaperoning by Ro60 and La autoantigens," which focuses on the molecular mechanisms of RNA chaperoning by the Ro60 (TROVE2) and La autoantigens. The research field associated with this citation is RNA biology and autoantigen function, specifically the structural and mechanistic analysis of Ro60/La proteins.