SHC1 Monoclonal antibody, PBS Only (Capture)

SHC1 Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 67194-2-PBS
Clone No.1A5B1

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

SHC, 1A5B1, SH2 domain protein C1, SHC transforming protein 1, SHC-transforming protein 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67194-2-PBS targets SHC1 as part of a matched antibody pair:

MP50763-1: 67194-2-PBS capture and 67194-3-PBS detection (validated in Cytometric bead array)

MP50763-3: 67194-2-PBS capture and 67194-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25173

Product name: Recombinant human SHC1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-169 aa of NM_183001

Sequence: MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCSFFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGC

Predict reactive species
Full Name SHC (Src homology 2 domain containing) transforming protein 1
Calculated Molecular Weight 63 kDa
Observed Molecular Weight66 kDa
GenBank Accession NumberNM_183001
Gene Symbol SHC1
Gene ID (NCBI) 6464
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP29353
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The proto-oncogene SHC family consists of SHCA, SHCB, SHCC, and SHCD4 gene members, which can encode 7 kinds of cohesive molecules. SHC family is widely expressed and functional. The SHC1 gene is located in zone 1, region 2 of human chromosome 1. SHC1 is believed to be involved in inhibiting neuronal apoptosis and regulating the receptor tyrosine kinase pathway. SHC1 sensitizes cancer cells to the 8-Cl-cAMP treatment.

Loading...
||
New chat

Able

正在加载,请稍候...