Filter: AllWBIHCIF/ICCCytometric bead array sample testCytometric bead array

WB analysis using 67198-1-Ig (same clone as 67198-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67198-1-Ig (UBE1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67198-1-PBS in a different storage buffer formulation.
WB analysis using 67198-1-Ig (same clone as 67198-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67198-1-Ig (UBE1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67198-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 67198-1-Ig (same clone as 67198-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67198-1-Ig (UBE1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67198-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 67198-1-Ig (same clone as 67198-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67198-1-Ig (UBE1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67198-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 67198-1-Ig (same clone as 67198-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67198-1-Ig (UBE1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67198-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 67198-1-Ig (same clone as 67198-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67198-1-Ig (UBE1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67198-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 67198-1-Ig (same clone as 67198-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67198-1-Ig (UBE1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67198-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 67198-1-Ig (same clone as 67198-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67198-1-Ig (UBE1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67198-1-PBS in a different storage buffer formulation.
IF Staining of HeLa using 67198-1-Ig (same clone as 67198-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using UBE1 antibody (67198-1-Ig, Clone: 1H7E8 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67198-1-PBS in a different storage buffer formulation.
Cytometric bead array sample test of MP51632-1
Cytometric bead array sample test of MP51632-1, UBE1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67198-2-PBS. Detection antibody: 67198-1-PBS.
Cytometric bead array standard curve of MP51632-1
Cytometric bead array standard curve of MP51632-1, UBE1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67198-2-PBS. Detection antibody: 67198-1-PBS. Standard:Ag8920. Range: 0.781-100 ng/mL.

UBE1 Monoclonal antibody, PBS Only (Detector)

Name: UBE1 Monoclonal antibody, PBS Only (Detector)
Brand: Proteintech
SKU: 67198-1-PBS

UBE1 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 67198-1-PBS

Clone No.1H7E8

Review Product

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

UBA1, 1H7E8, A1S9, A1S9T, A1ST

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

67198-1-PBS targets UBE1 as part of a matched antibody pair:

MP51632-1: 67198-2-PBS capture and 67198-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human, mouse, rat
Host / Isotype	Mouse / IgG2a
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag8920 Product name: Recombinant human UBE1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 711-1058 aa of BC013041 Sequence: CHHWHTQYSNNIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNPLHLDYVMAAANLFAQTYGLTGSQDRAAVATFLQSVQVPEFTPKSGVKIHVSDQELQSANASVDDSRLEELKATLPSPDKLPGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDIPSADRHKSKLIAGKIIPAIATTTAAVVGLVCLELYKVVQGHRQLDSYKNGFLNLALPFFGFSEPLAAPRHQYYNQEWTLWDRFEVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVPYVRYTIR Predict reactive species
Full Name	ubiquitin-like modifier activating enzyme 1
Calculated Molecular Weight	1058 aa, 118 kDa
Observed Molecular Weight	114-118 kDa
GenBank Accession Number	BC013041
Gene Symbol	UBA1
Gene ID (NCBI)	7317
RRID	AB_2882491
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P22314
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.