Use Able AI chat for product recommendations

S100A1 Monoclonal antibody, PBS Only (Capture)

S100A1 Monoclonal Antibody for IHC, Cytometric bead array, Indirect ELISA

Cat No. 67237-1-PBS
Clone No.1A8C1

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

IHC, Cytometric bead array, Indirect ELISA

1A8C1, Protein S100 A1, Protein S100-A1, S 100 protein alpha chain, S 100 protein subunit alpha

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67237-1-PBS targets S100A1 as part of a matched antibody pair:

MP51090-1: 67237-1-PBS capture and 67237-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19544

Product name: Recombinant human S100A1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-94 aa of BC014392

Sequence: MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

Predict reactive species
Full Name S100 calcium binding protein A1
Calculated Molecular Weight 94 aa, 11 kDa
GenBank Accession NumberBC014392
Gene Symbol S100A1
Gene ID (NCBI) 6271
RRIDAB_3085037
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP23297
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

S100A1 belongs to the S100 protein family, which represents the largest group among EF-hand Ca2+-binding proteins exclusively expressed in vertebrates. S100 proteins have been described as central regulators of numerous cellular and molecular processes, often operating in a cell-type-specific manner (PMID: 11991838). S100A1 is a central regulator of Ca2+-driven networks that orchestrates compartmentalized Ca2+ fluxes in the heart (PMID: 22336719, PMID: 26021637). S100A1 is primarily expressed in cardiomyocytes (CM). Endothelial cells (EC) express significantly lower S100A1 levels, whereas fibroblasts do not express S100A1 (PMID: 38641766).

Loading...
||
New chat

Able

正在加载,请稍候...