Use Able AI chat for product recommendations

MTH1 Monoclonal antibody

MTH1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67443-1-Ig
Clone No. 2D7G4
Publications (1)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA
For FC, select conjugated version.

NUDT1, 2D7G4, 2-hydroxy-dATP diphosphatase, 7,8-dihydro-8-oxoguanine triphosphatase, 8 oxo dGTPase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for MTH1 in ?

Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells
Positive IHC detected inhuman renal cell carcinoma tissue, mouse testis tissue, human colon cancer tissue, human lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67443-1-Ig targets MTH1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9802

Product name: Recombinant human NUDT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-179 aa of BC014618

Sequence: MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV

Predict reactive species
Full Name nudix (nucleoside diphosphate linked moiety X)-type motif 1
Calculated Molecular Weight179aa,20 kDa; 197aa,23 kDa
Observed Molecular Weight 19 kDa
GenBank Accession NumberBC014618
Gene Symbol MTH1
Gene ID (NCBI) 4521
RRIDAB_2882678
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP36639
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MTH1, also known as NUDT1 or 8-Oxo-dGTPase, is an important repair enzyme that prevents oxidative stress-induced DNA damage through hydrolyzing mutagenic 8-oxo-dGTP into 8-oxo-dGMP. MTH1 is expressed in postmitotic neurons as well as in proliferative tissues, and it is localized both in the mitochondria and nucleus. MTH1 might be a useful marker of oxidative stress and its level increased upon oxidative stress. Increased expression of MTH1 were also found in various cancer tissues and neurodegenerative diseases.

Protocols

Product Specific Protocols
IF protocol for MTH1 antibody 67443-1-IgDownload protocol
IHC protocol for MTH1 antibody 67443-1-IgDownload protocol
WB protocol for MTH1 antibody 67443-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The MTH1 Monoclonal antibody (2D7G4), catalog number 67443-1-Ig, has 1 total citation. It was cited in Nature Communications (Impact Factor 18.1) in a 2024 study titled "Coupling cellular drug-target engagement to downstream pharmacology with CeTEAM." The research field is pharmacology and drug-target engagement, utilizing Western blot (WB) on human samples.

SpeciesApplicationTitle
humanWB

Nat Commun

Coupling cellular drug-target engagement to downstream pharmacology with CeTEAM

Authors - Nicholas C K Valerie
Loading...
||
New chat

Able™

正在加载,请稍候...